WO2012138919A2 - Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) - Google Patents
Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) Download PDFInfo
- Publication number
- WO2012138919A2 WO2012138919A2 PCT/US2012/032415 US2012032415W WO2012138919A2 WO 2012138919 A2 WO2012138919 A2 WO 2012138919A2 US 2012032415 W US2012032415 W US 2012032415W WO 2012138919 A2 WO2012138919 A2 WO 2012138919A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- gdf
- gdf15
- polypeptide
- mice
- glucose
- Prior art date
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/495—Transforming growth factor [TGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the disclosed invention relates to the treatment or amelioration of a metabolic disorder, such as Type 2 diabetes, elevated glucose levels, elevated insulin levels, dyslipidemia, obesity or diabetic nephropathy, by administering a therapeutically effective amount of GDF 15 to a subject in need thereof.
- a metabolic disorder such as Type 2 diabetes, elevated glucose levels, elevated insulin levels, dyslipidemia, obesity or diabetic nephropathy
- GDF 15 Growth differentiation factor 15
- MICl macrophage inhibitory cytokine 1
- PLAB placental bone morphogenetic factor
- Human GDF15 gene is located on chromosome 19pl3.2-13.1; rat GDF15 gene is located on chromosome 16; and mouse GDF15 gene is located on chromosome 8.
- the GDF 15 open reading frames span two exons (Bottner M 1999, Gene. 237: 105-1 1 and NCBI).
- the mature GDF15 peptide shares low homology with other family members (Katoh M 2006, Int JMol Med. 17:951-5.).
- GDF15 is synthesized as a large precursor protein that is cleaved at the dibasic cleavage site to release the carboxyterminal mature peptide.
- the mouse and rat GDF15 prepro-peptides both contain 303 amino acids.
- Human full-length precursor contains 308 amino acids.
- the rodent mature peptides contain 115 amino acids after processing at the RGRR (SEQ ID NO: 13) cleavage site.
- the human mature peptide contains 1 12 amino acids after processing at the RGRRRAR (SEQ ID NO: 14) cleavage site.
- Human mature GDF15 peptide shared 66.1% and 68.1% sequence similarity with rat and mouse mature GDF15 peptides (Bottner M 1999, Gene. 237: 105-11 ; Bauskin AR 2000, EMBO J. 19:2212-20; NCBI). There is no glycosylation site in the mature GDF 15 peptide.
- the mature GDF 15 peptide contains the seven conserved cysteine residues required for the formation of the cysteine knot motif and the single interchain disulfide bond that are typical for TGFP superfamily members.
- the mature peptide further contains two additional cysteine residues that form a fourth intrachain disulfide bond.
- Biologically active GDF 15 is a 25kD homodimer of the mature peptide covalently linked by one interchain disulfide bond.
- GDF 15 circulating levels have been reported to be elevated in multiple pathological and physiological conditions, most notably pregnancy (Moore AG 2000. J Clin Endocrinol Metab 85: 4781 ⁇ 1788), ⁇ -thalassemia (Tanno T 2007, Nat Med 13: 1096-101) (Zimmermann MB, 2008 Am J Clin Nutr 88: 1026-31), congenital dyserythropoietic anemia (Tamary H 2008, Blood. 1 12:5241-4). GDF15 has also been linked to multiple biological activities in literature reports.
- GDF 15 may be protective against ischemic/reperfusion- or overload-induced heart injury (Kempf T, 2006, Circ R 3 ⁇ 4.98:351-60) (Xu J, 2006, Circ Res. 98:342-50), protective against aging- associated motor neuron and sensory neuron loss (Strelau J, 2009, J Neurosci. 29 : 13640-8.), mildly protective against metabolic acidosis in kidney, and may cause cachexia in cancer patients (Johnen H 2007 Nat Med. 1 1 : 1333-40). Many groups also studied the role of GDF15 in cell apoptosis and proliferation and reported controversial results using different cell culture and xenograft models.
- GDF 15 is protective against carcinogen or Ape mutation induced neoplasia in intestine and lung (Baek SJ 2006, Gastroenterology. 131 : 1553-60) (Cekanova M 2009, Cancer Prev Res 2:450-8. ).
- a method of treating a metabolic disorder comprises administering to a subject in need thereof a therapeutically effective amount of an isolated human GDF 15 polypeptide.
- the metabolic disorder is type 2 diabetes, dyslipidemia, obesity, or diabetic nephropathy.
- the metabolic disorder comprises a condition in which the subject has a fasting blood glucose level of greater than or equal to 100 mg/dL.
- the subject on which the method is performed can be a mammal, for example a human.
- the GDF 15 protein comprises one of SEQ ID NOS:2, 6 and 10 and/or is encoded by the nucleic acid sequence of SEQ ID NO:9.
- the GDF 15 polypeptide is administered in the form of a pharmaceutical composition comprising the GDF15 polypeptide in admixture with a pharmaceutically-acceptable carrier.
- the provided method further comprises the step of determining the subject's blood glucose level at a timepoint subsequent to the administration.
- the method further comprises the step of determining the subject's serum insulin level at a timepoint subsequent to the administration.
- the method comprises administering to a subject in need thereof a therapeutically effective amount of an isolated human GDF 15 polypeptide comprising an amino acid sequence that has at least 90% sequence identity with one of SEQ ID NOS:2, 6 and 10.
- the metabolic disorder is type 2 diabetes, dyslipidemia, obesity, or diabetic nephropathy.
- the metabolic disorder comprises a condition in which the subject has a fasting blood glucose level of greater than or equal to 100 mg/dL.
- the subject on which the method is performed can be a mammal, for example a human.
- the GDF15 protein comprises one of SEQ ID NOS:2, 6 and 10 and/or is encoded by one SEQ ID NOS: l, 5 and 9.
- the GDF15 polypeptide is administered in the form of a pharmaceutical composition comprising the GDF 15 polypeptide in admixture with a pharmaceutically-acceptable carrier.
- the provided method further comprises the step of determining the subject's blood glucose level at a timepoint subsequent to the administration.
- the method further comprises the step of determining the subject's serum insulin level at a timepoint subsequent to the administration.
- Figure 1 is a series of two bar graphs showing the regulation of GDF15 expression in murine liver (Figure 1A) and murine fat (Figure IB) by nutritional states.
- Figure 2 is a series of two bar graphs showing the upregulation of GDF15 expression in murine liver (Figure 2A) and murine 3T3-L1 adipocytes (Figure 2B) by PPAR agonists.
- Figure 3 is a series of plots and bar graphs showing the improvement in the metabolic profile of leptin-deficient ob/ob mice following AAV-mediated treatment with murine GDF 15; the effect of AAV murine GDF15 injection on plasma glucose levels (Figure 3A) and body weight (Figure 3C) were measured for two months.
- Plasma insulin levels were measured two weeks after AAV injection ( Figure 3B) and average daily food intake was measured three weeks after AAV injection ( Figure 3D).
- Total cholesterol (Figure 3E), NEFA ( Figure 3F), triglyceride (Figure 3G) and insulin levels (Figure 3H) were measured two months after AAV injection.
- Figure 4 is a series of two plots and two bar graphs showing the glucose lowering activity of AAV-mediated treatment of ob/ob mice with murine GDF15 and demonstrating that the glucose lowering effect is independent of reduced body weight.
- the pair-feeding study includes 3 groups of animals; one group injected with control AVV and had free access to food, a second group injected with AAV GDF 15 and had free access to food, and a third group injected with control AVV was fed the same amount of food that was consumed by the group of animals injected with GDF15 AAV on the previous day.
- Figure 4A The ratio of food intake to body weight over time in mice injected with GDF 15 or control AAV is shown in Figure 4A;
- Figure 4B shows body weight over time in mice fed ad libitum treated with control or GDF 15 AAV and in mice pair fed injected with control AAV;
- Figure 4C shows plasma glucose levels at the end of the pair- feeding study;
- Figure 4D shows body weight at the end of the pair-feeding study.
- Figure 5 is a series of four plots and two bar graphs showing the effects of murine
- GDF15 AAV on plasma glucose levels, body weight and food intake, respectively in mice fed a high fat diet ( Figures 5A-5C) and the same thing in mice fed a normal chow diet ( Figures 5D-5F).
- Figure 6 is a series of four plots showing the effect of AAV-mediated treatment with murine GDF15 on insulin sensitivity and glucose tolerance in mice fed a high fat diet;
- Figures 6A and 6B show the plasma glucose and plasma insulin levels, respectively, measured during OGTT three weeks post AAV injection, and
- Figures 6C and 6D show plasma glucose and plasma glucose/basal glucose levels measured during ITT two weeks post AAV injection.
- Figure 7 is a series of a plot and four bar graphs showing the effect of AAV-mediated human GDF15 treatment of DIO mice on glucose levels (Figure 7A); food intake (Figure 7B); body weight (Figure 7C); and the amount of human GDF15 expressed in DIO mice ( Figure 7D).
- Figure 8 is a plot and two bar graphs showing the effect of AAV-mediated human GDF 15 on the progression of glucose intolerance in KKAy mice;
- Figure 8A shows plasma glucose levels during an OGTT;
- Figure 9 is a series of nine bar graphs showing the effect of AAV-mediated human GDF 15 on glucosuria in KKAy mice over a 3-4 week period;
- Figure 9A shows urine glucose levels;
- Figure 9F water intake;
- Figure 9J shows body weight and Figure 9K food intake.
- Figure 10 is a series of four bar graphs showing the effect of AAV-mediated murine
- GDF 15 on the total body mass (Figure 10A); fat mass ( Figure 10B); fat mass/total body mass (Figure IOC); and non-fat mass/total body mass (Figure 10D) in DIO mice.
- Figure 11 is a series of two plots and six bar graphs showing the effect of AAV- mediated human GDF15 on DIO mice;
- Figure 1 1A shows body weight;
- Figure 11B the amount of human GDF15 expressed;
- Figure 11C total body mass;
- Figure 11H percent of non-fat mass/total body mass Figure 11 is a series of two plots and six bar graphs showing the effect of AAV- mediated human GDF15 on DIO mice;
- Figure 1 1A shows body weight;
- Figure 11B the amount of human GDF15 expressed;
- Figure 11C total body mass;
- Figure 11H percent of non-fat mass/total body mass is a series of two plots and six bar graphs
- Figure 12 is a series of three bar graphs showing the effect of recombinant murine GDF 15 on glucose and food intake in ob/ob mice;
- Figure 12A shows plasma glucose levels;
- Figure 12C food intake at day 1 and 2 after the injection of vehicle or murine GDF 15.
- Figure 13 is a series of three bar graphs showing the effect of recombinant human GDF15 on plasma glucose levels, food intake and body weight in ob/ob mice;
- Figure 13A shows plasma glucose levels;
- Figure 13B food intake;
- Figure 13C body weight.
- Figure 14 is a series of a plot and two bar graphs showing the effect of recombinant human GDF 15 in DIO mice;
- Figure 14A shows plasma glucose levels measured during OGTT 3 days after protein injection;
- Figure 14B food intake;
- Figure 14C body weight is a series of a plot and two bar graphs showing the effect of recombinant human GDF 15 in DIO mice.
- Figure 15 is a plot and a bar graph showing the effect of recombinant human GDF 15 on lipid metabolism in B6D2F1 male mice following an oral lipid challenge;
- Figure 15A shows plasma triglyceride levels during the lipid tolerance test; and
- Figure 15B shows plasma exposure of recombinant human GDF 15.
- Figure 16 is a series of four bar graphs showing the blood chemistry of B6D21F mice fed a high-fat diet for three weeks after AAV-mediated murine GDF 15 administration;
- Figure 16A shows plasma insulin levels;
- Figure 16B non-esterified fatty acid ( EFA) levels;
- Figure 16C total cholesterol levels; and
- the instant disclosure provides a method of treating a metabolic disorder, such as Type 2 diabetes mellitus (referred to interchangeably herein as "tyP e 2 diabetes"), elevated glucose levels, elevated insulin levels, dyslipidemia or obesity, by administering to a subject in need thereof a therapeutically effective amount of an isolated human GDF 15 polypeptide. Methods of administration and delivery are also provided.
- a metabolic disorder such as Type 2 diabetes mellitus (referred to interchangeably herein as "tyP e 2 diabetes”
- TMP e 2 diabetes Type 2 diabetes mellitus
- elevated glucose levels such as elevated insulin levels, dyslipidemia or obesity
- Methods of administration and delivery are also provided.
- amino acid and “residue” are interchangeable and, when used in the context of a peptide or polypeptide, refer to both naturally occurring and synthetic amino acids, as well as amino acid analogs, amino acid mimetics and non-naturally occurring amino acids that are chemically similar to the naturally occurring amino acids.
- a "naturally occurring amino acid” is an amino acid that is encoded by the genetic code, as well as those amino acids that are encoded by the genetic code that are modified after synthesis, e.g., hydroxyproline, ⁇ -carboxyglutamate, and O-phosphoserine.
- An amino acid analog is a compound that has the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
- Such analogs can have modified R groups (e.g., norleucine) or modified peptide backbones, but will retain the same basic chemical structure as a naturally occurring amino acid.
- amino acid mimetic is a chemical compound that has a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. Examples include a methacryloyl or acryloyl derivative of an amide, ⁇ -, ⁇ -, ⁇ -imino acids (such as piperidine-4-carboxylic acid) and the like.
- non-naturally occurring amino acid is a compound that has the same basic chemical structure as a naturally occurring amino acid, but is not incorporated into a growing polypeptide chain by the translation complex.
- Non-naturally occurring amino acid also includes, but is not limited to, amino acids that occur by modification (e.g., posttranslational modifications) of a naturally encoded amino acid (including but not limited to, the 20 common amino acids) but are not themselves naturally incorporated into a growing polypeptide chain by the translation complex.
- non-limiting lists of examples of non- naturally occurring amino acids that can be inserted into a polypeptide sequence or substituted for a wild-type residue in polypeptide sequence include ⁇ -amino acids, homoamino acids, cyclic amino acids and amino acids with derivatized side chains.
- Examples include (in the L-form or D-form; abbreviated as in parentheses): citrulline (Cit), homocitrulline (hCit), Na-methylcitrulline ( MeCit), Na-methylhomocitrulline (Na- MeHoCit), ornithine (Orn), Na-Methylornithine (Na-MeOrn or NMeOrn), sarcosine (Sar), homolysine (hLys or hK), homoarginine (hArg or hR), homoglutamine (hQ), Na-methylarginine (NMeR), Na-methylleucine (Na-MeL or NMeL), N-methylhomolysine (NMeHoK), Na-methylglutamine (NMeQ), norleucine (Nle), norvaline (Nva), 1,2,3,4- tetrahydroisoquinoline (Tic), Octahydroindole-2-carboxylic acid (
- isolated nucleic acid molecule refers to a single or double-stranded polymer of deoxyribonucleotide or ribonucleotide bases read from the 5' to the 3' end (e.g., a GDF 15 nucleic acid sequence provided herein), or an analog thereof, that has been separated from at least about 50 percent of polypeptides, peptides, lipids, carbohydrates, polynucleotides or other materials with which the nucleic acid is naturally found when total nucleic acid is isolated from the source cells.
- an isolated nucleic acid molecule is substantially free from any other contaminating nucleic acid molecules or other molecules that are found in the natural environment of the nucleic acid that would interfere with its use in polypeptide production or its therapeutic, diagnostic, prophylactic or research use.
- isolated polypeptide and “isolated protein” are used interchangeably and refer to a polypeptide (e.g., a GDF15 polypeptide provided herein) that has been separated from at least about 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, or 99 percent of the polypeptides, peptides, lipids, carbohydrates, polynucleotides, or other materials with which the polypeptide is naturally found when isolated from a source cell.
- the isolated polypeptide is substantially free from any other contaminating polypeptides or other contaminants that are found in its natural environment that would interfere with its therapeutic, diagnostic, prophylactic or research use.
- encoding refers to a polynucleotide sequence encoding one or more amino acids. The term does not require a start or stop codon.
- An amino acid sequence can be encoded in any one of six different reading frames provided by a polynucleotide sequence.
- nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same.
- Percent identity means the percent of identical residues between the amino acids or nucleotides in the compared molecules and is calculated based on the size of the smallest of the molecules being compared. For these calculations, gaps in alignments (if any) can be addressed by a particular mathematical model or computer program (i.e., an "algorithm”). Methods that can be used to calculate the identity of the aligned nucleic acids or polypeptides include those described in, e.g., Computational Molecular Biology, (Lesk, A.
- the sequences being compared are aligned in a way that gives the largest match between the sequences.
- the computer program used to determine percent identity is the GCG program package, which includes GAP (Devereux et al, (1984) Nucl. Acid Res. 12:387; Genetics Computer Group, University of Wisconsin, Madison, WI).
- GAP is used to align the two polypeptides or polynucleotides for which the percent sequence identity is to be determined.
- the sequences are aligned for optimal matching of their respective amino acid or nucleotide (the "matched span", as determined by the algorithm).
- a gap opening penalty (which is calculated as 3x the average diagonal, wherein the "average diagonal” is the average of the diagonal of the comparison matrix being used; the “diagonal” is the score or number assigned to each perfect amino acid match by the particular comparison matrix) and a gap extension penalty (which is usually 1/10 times the gap opening penalty), as well as a comparison matrix such as PAM 250 or BLOSUM 62 are used in conjunction with the algorithm.
- a standard comparison matrix (see, Dayhoff et al, (1978) Atlas of Protein Sequence and Structure 5:345-352 for the PAM 250 comparison matrix; Henikoff et al, (1992) Proc. Natl. Acad. Sci. U.S.A. 89: 10915-10919 for the BLOSUM 62 comparison matrix) is also used by the algorithm.
- Certain alignment schemes for aligning two amino acid sequences can result in matching of only a short region of the two sequences, and this small aligned region can have very high sequence identity even though there is no significant relationship between the two full-length sequences. Accordingly, the selected alignment method (e.g., the GAP program) can be adjusted if so desired to result in an alignment that spans at least 50 contiguous amino acids of the target polypeptide.
- the selected alignment method e.g., the GAP program
- GDF15 polypeptide and "GDF15 protein” are used interchangeably and mean a naturally-occurring wild-type polypeptide expressed in a mammal, such as a human or a mouse.
- GDF15 polypeptide can be used interchangeably to refer to any full-length GDF 15 polypeptide, e.g., SEQ ID NO:2, which consist of 308 amino acid residues and which is encoded by the nucleotide sequence SEQ ID NOs: l (which, when expressed recombinantly, may but need not comprise a stop codon); any form comprising the active and prodomains of the polypeptide, e.g., SEQ ID NO:6, which consist of 279 amino acid residues and which is encoded by the nucleotide sequence SEQ ID NO:5 (which, when expressed recombinantly, may but need not comprise a stop codon), and in which the 29 amino acid residues at the amino-terminal end of the full-length GDF 15 polypeptide, e.g.
- GDF15 polypeptide also encompasses a GDF15 polypeptide in which a naturally occurring GDF15 polypeptide sequence (e.g., SEQ ID NOs:2, 6 or 10) has been modified. Such modifications include, but are not limited to, one or more amino acid substitutions, including substitutions with non-naturally occurring amino acids non-naturally- occurring amino acid analogs and amino acid mimetics.
- a naturally occurring GDF15 polypeptide sequence e.g., SEQ ID NOs:2, 6 or 10
- modifications include, but are not limited to, one or more amino acid substitutions, including substitutions with non-naturally occurring amino acids non-naturally- occurring amino acid analogs and amino acid mimetics.
- a GDF 15 polypeptide comprises an amino acid sequence that is at least about 85 percent identical to a naturally-occurring GDF15 polypeptide (e.g., SEQ ID NOs:2, 6 or 10). In other embodiments, a GDF15 polypeptide comprises an amino acid sequence that is at least about 90 percent, or about 95, 96, 97, 98, or 99 percent identical to a naturally-occurring GDF15 polypeptide amino acid sequence (e.g., SEQ ID NOs:2, 6 or 10).
- Such GDF 15 polypeptides preferably, but need not, possess at least one activity of a wild-type GDF15 polypeptide, such as the ability to lower blood glucose, insulin, triglyceride, or cholesterol levels; the ability to reduce body weight; or the ability to improve glucose tolerance, energy expenditure, or insulin sensitivity.
- the present invention also encompasses nucleic acid molecules encoding such GDF15 polypeptide sequences.
- a GDF15 polypeptide can comprise a signal sequence (residues 1-29 of SEQ ID NO:2) or it can have the signal sequence removed (providing SEQ ID NO:6).
- a human GDF15 polypeptide can have the signal sequence removed and can also be cleaved at residue 198, separating the primary sequence of the prodomain (residues 30-198 of SEQ ID NO:2) from the primary sequence of the active domain.
- the naturally-occurring biologically active form of the GDF 15 polypeptide is a homodimer of the processed mature peptide (residues 199-308 of SEQ ID NO:2).
- a GDF 15 polypeptide can be used to treat or ameliorate a metabolic disorder in a subject is a mature form of GDF 15 polypeptide that is derived from the same species as the subject.
- a GDF 15 polypeptide is preferably biologically active.
- a GDF 15 polypeptide has a biological activity that is equivalent to, greater to or less than that of the naturally occurring form of the mature GDF 15 protein from which the signal peptide has been removed from the N- terminus of the full length GDF 15 sequence and in which the prodomain has been cleaved (but not necessarily removed from) the active domain.
- biological activities include the ability to lower blood glucose, insulin, triglyceride, or cholesterol levels; the ability to reduce body weight; or the ability to improve glucose tolerance, lipid tolerance, or insulin sensitivity; the ability to lower urine glucose and protein excretion.
- terapéuticaally effective dose and "therapeutically effective amount,” as used herein, means an amount of GDF 15 polypeptide that elicits a biological or medicinal response in a tissue system, animal, or human being sought by a researcher, physician, or other clinician, which includes alleviation or amelioration of the symptoms of the disease or disorder being treated, i.e., an amount of a GDF 15 polypeptide that supports an observable level of one or more desired biological or medicinal response, for example lowering blood glucose, insulin, triglyceride, or cholesterol levels; reducing body weight; or improving glucose tolerance, energy expenditure, or insulin sensitivity.
- a GDF 15 polypeptide described by the instant disclosure can be engineered and/or produced using standard molecular biology methodology.
- a nucleic acid sequence encoding a GDF 15, which can comprise all or a portion of SEQ ID NOs:2, 6 or 10 can be isolated and/or amplified from genomic DNA, or cDNA using appropriate oligonucleotide primers. Primers can be designed based on the nucleic and amino acid sequences provided herein according to standard (RT)-PCR amplification techniques. The amplified GDF 15 nucleic acid can then be cloned into a suitable vector and characterized by DNA sequence analysis.
- Oligonucleotides for use as probes in isolating or amplifying all or a portion of the GDF 15 sequences provided herein can be designed and generated using standard synthetic techniques, e.g., automated DNA synthesis apparatus, or can be isolated from a longer sequence of DNA.
- GDF15 is expressed as a contiguous amino acid sequence comprising a signal sequence, a pro domain and an active domain.
- the 308 amino acid sequence of full length human GDF15 is (shown with an optional N-terminal methionine codon in parentheses): (M)PGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSEL
- the 303 amino acid sequence of full length murine GDF15 is (shown with an optional N-terminal methionine codon in parentheses): (M)APPALQAQPPGGSQLRFLLFLLLLLLSWPSQGDALAMPEQRPSG PESQLNADELRGRFQDLLSRLHANQSREDSNSEPSPDPAVRILSPEVRL GSHGQLLLRV RASLSQGLPEAYRVHRALLLLTPTARPWDITRPLKRA LSLRGPRAPALRLRLTPPPDLAMLP SGGTQLELRLRVAAGRGRRSAHA
- HPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGEC PHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSG VSLQTYDDLVARGCHCA (SEQ ID NO:4) and is encoded by the DNA sequence (shown with an optional N-terminal methionine codon in parentheses, and optional stop codon):
- amino acid sequence of human GDF15 following cleavage of the 29 residue signal sequence is (shown with an optional N-terminal methionine codon in parentheses):
- amino acid sequence of murine GDF 15 following cleavage of the 32 residue signal sequence is (shown with an optional N-terminal methionine codon in parentheses):
- amino acid sequence of the recombinant active form of the human GDF15 which comprises a homodimer comprising nine intermolecular disulfide bonds (shown with an optional N-terminal methionine residue in parentheses), is:
- the amino acid sequence of the recombinant active form of the murine GDF15 which comprises a homodimer comprising nine intermolecular disulfide bonds (shown with an optional N-terminal methionine codon in parentheses), is: (M)SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLS MCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLM HRTDSGVSLQTYDDLVARGCHCA (SEQ ID NO: 12) and is encoded by the DNA sequence (shown with an optional N-terminal methionine codon in parentheses, and optional stop codon): (ATG ) AGCGCGCATGCGCACCCAAGAGACTCGTGCCCACTGGGTCCGGGGCGCTGCTGTCACCTGGAGACTGTGC AGGCAACTCTTGAAGACTTGGGCTGGAGCGACTGGGTGTTGTCCCCGCGCCAGCTGCAGCTGAGCATGTGCGTGG GCGA
- GDF 15 polypeptide refers to a GDF polypeptide comprising the human amino acid sequences SEQ ID NOs:2, 6 and 10.
- GDF15 polypeptide also encompasses polypeptides comprising an amino acid sequence that differs from the amino acid sequence of a naturally occurring GDF polypeptide sequence, e.g., SEQ ID NOs:2, 6 and 10, by one or more amino acids, such that the sequence is at least 85% identical to SEQ ID NOs:2, 6 and 10.
- GDF polypeptides can be generated by introducing one or more amino acid substitutions, either conservative or non-conservative and using naturally or non-naturally occurring amino acids, at particular positions of the GDF 15 polypeptide.
- a “conservative amino acid substitution” can involve a substitution of a native amino acid residue (i.e., a residue found in a given position of the wild-type FGF21 polypeptide sequence) with a non-native residue (i.e., a residue that is not found in that same position of the wild-type FGF21 polypeptide sequence) such that there is little or no effect on the polarity or charge of the amino acid residue at that position.
- Conservative amino acid substitutions also encompass non-naturally occurring amino acid residues that are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include peptidomimetics, and other reversed or inverted forms of amino acid moieties.
- Naturally occurring residues can be divided into classes based on common side chain properties:
- Additional groups of amino acids can also be formulated using the principles described in, e.g., Creighton (1984) PROTEINS: STRUCTURE AND MOLECULAR PROPERTIES (2d Ed. 1993), W.H. Freeman and Company. In some instances it can be useful to further characterize substitutions based on two or more of such features (e.g., substitution with a "small polar" residue, such as a Thr residue, can represent a highly conservative substitution in an appropriate context).
- Conservative substitutions can involve the exchange of a member of one of these classes for another member of the same class.
- Non-conservative substitutions can involve the exchange of a member of one of these classes for a member from another class.
- Synthetic, rare, or modified amino acid residues having known similar physiochemical properties to those of an above-described grouping can be used as a "conservative" substitute for a particular amino acid residue in a sequence.
- a D- Arg residue may serve as a substitute for a typical L-Arg residue.
- a particular substitution can be described in terms of two or more of the above described classes (e.g., a substitution with a small and hydrophobic residue means substituting one amino acid with a residue(s) that is found in both of the above-described classes or other synthetic, rare, or modified residues that are known in the art to have similar physiochemical properties to such residues meeting both definitions).
- GDF15 polypeptide provided herein, including those degenerate to SEQ ID NOs: l, 5 and 9, and those encoding polypeptide variants of SEQ ID NOs:2, 6 and 10 form other aspects of the instant disclosure. ⁇ . ⁇ . GDF 15 Vectors
- the appropriate coding sequences e.g., SEQ ID NOs: l, 5 or 9
- the sequence can be expressed to produce the encoded polypeptide according to standard cloning and expression techniques, which are known in the art (e.g., as described in Sambrook, J., Fritsh, E. F., and Maniatis, T. Molecular Cloning: A Laboratory Manual 2nd, ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989).
- the invention also relates to such vectors comprising a nucleic acid sequence according to the invention.
- a “vector” refers to a delivery vehicle that (a) promotes the expression of a polypeptide-encoding nucleic acid sequence; (b) promotes the production of the polypeptide therefrom; (c) promotes the transfection/transformation of target cells therewith; (d) promotes the replication of the nucleic acid sequence; (e) promotes stability of the nucleic acid; (f) promotes detection of the nucleic acid and/or transformed/transfected cells; and/or (g) otherwise imparts advantageous biological and/or physiochemical function to the polypeptide-encoding nucleic acid.
- a vector can be any suitable vector, including chromosomal, non-chromosomal, and synthetic nucleic acid vectors (a nucleic acid sequence comprising a suitable set of expression control elements).
- suitable vectors include derivatives of SV40, bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and viral nucleic acid (RNA or DNA) vectors.
- a recombinant expression vector can be designed for expression of a GDF15 protein in prokaryotic (e.g., E. coli) or eukaryotic cells (e.g., insect cells, using baculovirus expression vectors, yeast cells, or mammalian cells).
- prokaryotic e.g., E. coli
- eukaryotic cells e.g., insect cells, using baculovirus expression vectors, yeast cells, or mammalian cells.
- Representative host cells include those hosts typically used for cloning and expression, including Escherichia coli strains TOP 10F', TOP 10, DH10B, DH5a, HB 101, W3110, BL21(DE3) and BL21 (DE3)pLysS, BLUESCRIPT (Stratagene), mammalian cell lines CHO, CHO-K1, HEK293, 293-EBNA pIN vectors (Van Heeke & Schuster, J. Biol. Chem. 264: 5503-5509 (1989); pET vectors (Novagen, Madison Wis.).
- the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase and an in vitro translation system.
- the vector contains a promoter upstream of the cloning site containing the nucleic acid sequence encoding the polypeptide. Examples of promoters, which can be switched on and off, include the lac promoter, the T7 promoter, the trc promoter, the tac promoter and the trp promoter.
- vectors comprising a nucleic acid sequence encoding
- the vectors comprise an operably linked nucleotide sequence which regulates the expression of GDF 15.
- a vector can comprise or be associated with any suitable promoter, enhancer, and other expression-facilitating elements. Examples of such elements include strong expression promoters (e.g., a human CMV IE promoter/enhancer, an RSV promoter, SV40 promoter, SL3-3 promoter, MMTV promoter, or HIV LTR promoter, EF1 alpha promoter, CAG promoter), effective poly (A) termination sequences, an origin of replication for plasmid product in E.
- strong expression promoters e.g., a human CMV IE promoter/enhancer, an RSV promoter, SV40 promoter, SL3-3 promoter, MMTV promoter, or HIV LTR promoter, EF1 alpha promoter, CAG promoter
- effective poly (A) termination sequences e.g., an origin of replication for plasmid product in E.
- Vectors also can comprise an inducible promoter as opposed to a constitutive promoter such as CMV IE.
- a nucleic acid comprising a sequence encoding a GDF15 polypeptide which is operatively linked to a tissue specific promoter which promotes expression of the sequence in a metabolically-relevant tissue, such as liver or pancreatic tissue is provided.
- host cells comprising the GDF 15 nucleic acids and vectors disclosed herein are provided.
- the vector or nucleic acid is integrated into the host cell genome, which in other embodiments the vector or nucleic acid is extra-chromosomal.
- Recombinant cells such as yeast, bacterial (e.g., E. coli), and mammalian cells (e.g., immortalized mammalian cells) comprising such a nucleic acid, vector, or combinations of either or both thereof are provided.
- cells comprising a non- integrated nucleic acid such as a plasmid, cosmid, phagemid, or linear expression element, which comprises a sequence coding for expression of a GDF15 polypeptide, are provided.
- a vector comprising a nucleic acid sequence encoding a GDF 15 polypeptide provided herein can be introduced into a host cell by transformation or by transfection. Methods of transforming a cell with an expression vector are well known.
- a GDF 15 -encoding nucleic acid can be positioned in and/or delivered to a host cell or host animal via a viral vector. Any suitable viral vector can be used in this capacity.
- a viral vector can comprise any number of viral polynucleotides, alone or in combination with one or more viral proteins, which facilitate delivery, replication, and/or expression of the nucleic acid of the invention in a desired host cell.
- the viral vector can be a polynucleotide comprising all or part of a viral genome, a viral protein/nucleic acid conjugate, a virus-like particle (VLP), or an intact virus particle comprising viral nucleic acids and a GDF 15 polypeptide-encoding nucleic acid.
- VLP virus-like particle
- a viral particle viral vector can comprise a wild-type viral particle or a modified viral particle.
- the viral vector can be a vector which requires the presence of another vector or wild-type virus for replication and/or expression (e.g., a viral vector can be a helper-dependent virus), such as an adenoviral vector amplicon.
- a viral vector can be a helper-dependent virus
- such viral vectors consist of a wild-type viral particle, or a viral particle modified in its protein and/or nucleic acid content to increase transgene capacity or aid in transfection and/or expression of the nucleic acid (examples of such vectors include the herpes virus/AAV amplicons).
- a viral vector is similar to and/or derived from a virus that normally infects humans.
- Suitable viral vector particles include, for example, adenoviral vector particles (including any virus of or derived from a virus of the adenoviridae), adeno-associated viral vector particles (AAV vector particles) or other parvoviruses and parvoviral vector particles, papillomaviral vector particles, flaviviral vectors, alphaviral vectors, herpes viral vectors, pox virus vectors, retroviral vectors, including lentiviral vectors.
- adenoviral vector particles including any virus of or derived from a virus of the adenoviridae
- AAV vector particles adeno-associated viral vector particles
- papillomaviral vector particles include, for example, papillomaviral vector particles, flaviviral vectors, alphaviral vectors, herpes viral vectors, pox virus vectors, retroviral vectors, including lentiviral vectors.
- IIP Isolation of a GDF15 Polypeptide
- a GDF15 polypeptide expressed as described herein can be isolated using standard protein purification methods.
- a GDF15 polypeptide can be isolated from a cell in which is it naturally expressed or it can be isolated from a cell that has been engineered to express GDF 15, for example a cell that does not naturally express GDF15.
- Protein purification methods that can be employed to isolate a GDF 15 polypeptide, as well as associated materials and reagents, are known in the art. Exemplary methods of purifying a GDF 15 polypeptide are provided in the Examples herein below. Additional purification methods that may be useful for isolating a GDF 15 polypeptide can be found in references such as Bootcov MR, 1997, Proc. Natl. Acad. Sci. USA 94:11514-9, Fairlie WD, 2000, Gene 254: 67-76.
- compositions Comprising a GDF15 Polypeptide
- compositions comprising a GDF 15 polypeptide are provided.
- GDF 15 polypeptide pharmaceutical compositions can comprise a therapeutically effective amount of a GDF 15 polypeptide in admixture with a pharmaceutically or physiologically acceptable formulation agent selected for suitability with the mode of administration.
- pharmaceutically acceptable carrier or “physiologically acceptable carrier” as used herein refers to one or more formulation agents suitable for accomplishing or enhancing the delivery of a GDF 15 polypeptide into the body of a human or non-human subject.
- the term includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- Examples of pharmaceutically acceptable carriers include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof. In some cases it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in a pharmaceutical composition. Pharmaceutically acceptable substances such as wetting or minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the GDF 15 polypeptide can also act as, or form a component of, a carrier. Acceptable pharmaceutically acceptable carriers are preferably nontoxic to recipients at the dosages and concentrations employed.
- a pharmaceutical composition can contain formulation agent(s) for modifying, maintaining, or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption, or penetration of the composition.
- formulation agent(s) for modifying, maintaining, or preserving for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption, or penetration of the composition.
- Suitable formulation agents include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine, or lysine), antimicrobials, antioxidants (such as ascorbic acid, sodium sulfite, or sodium hydrogen-sulfite), buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates, or other organic acids), bulking agents (such as mannitol or glycine), chelating agents (such as ethylenediamine tetraacetic acid (EDTA)), complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin, or hydroxypropyl-beta-cyclodextrin), fillers, monosaccharides, disaccharides, and other carbohydrates (such as glucose, mannose, or dextrins), proteins (such as serum albumin, gelatin, or immunoglobulins), coloring, flavoring and diluting agents, emuls
- compositions can influence the physical state, stability, rate of in vivo release, and rate of in vivo clearance of the a GDF15 polypeptide.
- the primary vehicle or carrier in a pharmaceutical composition can be either aqueous or non-aqueous in nature.
- a suitable vehicle or carrier for injection can be water, physiological saline solution, or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration.
- Neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles.
- Other exemplary pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about pH 4.0-5.5, which can further include sorbitol or a suitable substitute.
- FGF21 polypeptide mutant compositions can be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's PHARMACEUTICAL SCIENCES, supra) in the form of a lyophilized cake or an aqueous solution.
- optional formulation agents Remington's PHARMACEUTICAL SCIENCES, supra
- the GDF15 polypeptide product can be formulated as a lyophilizate using appropriate excipients such as sucrose.
- the GDF15 polypeptide pharmaceutical compositions can be selected for parenteral delivery. Alternatively, the compositions can be selected for inhalation or for delivery through the digestive tract, such as orally. The preparation of such pharmaceutically acceptable compositions is within the skill of the art.
- the formulation components are present in concentrations that are acceptable to the site of administration.
- buffers are used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8.
- the therapeutic compositions for use in this invention can be in the form of a pyrogen-free, parenterally acceptable, aqueous solution comprising the desired GDF15 polypeptide in a pharmaceutically acceptable vehicle.
- a particularly suitable vehicle for parenteral injection is sterile distilled water in which a GDF 15 polypeptide is formulated as a sterile, isotonic solution, properly preserved.
- Yet another preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads, or liposomes, that provides for the controlled or sustained release of the product which can then be delivered via a depot injection.
- Hyaluronic acid can also be used, and this can have the effect of promoting sustained duration in the circulation.
- Other suitable means for the introduction of the desired molecule include implantable drug delivery devices.
- a pharmaceutical composition can be formulated for inhalation.
- a GDF 15 polypeptide can be formulated as a dry powder for inhalation.
- GDF 15 polypeptide inhalation solutions can also be formulated with a propellant for aerosol delivery.
- solutions can be nebulized. Pulmonary administration is further described in International Publication No. WO 94/20069, which describes the pulmonary delivery of chemically modified proteins.
- GDF 15 polypeptides that are administered in this fashion can be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
- a capsule can be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized.
- Additional agents can be included to facilitate absorption of the GDF 15 polypeptide. Diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders can also be employed.
- Another pharmaceutical composition can involve an effective quantity of a GDF 15 polypeptide in a mixture with non-toxic excipients that are suitable for the manufacture of tablets.
- excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
- GDF 15 polypeptide pharmaceutical compositions will be evident to those skilled in the art, including formulations involving GDF 15 polypeptides in sustained- or controlled-delivery formulations.
- Techniques for formulating a variety of other sustained- or controlled-delivery means such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art (see, e.g., International Publication No. WO 93/15722, which describes the controlled release of porous polymeric microparticles for the delivery of pharmaceutical compositions, and Wischke & Schwendeman, 2008, Int. J. Pharm. 364: 298-327, and Freiberg & Zhu, 2004, Int. J. Pharm. 282: 1-18, which discuss microsphere/microparticle preparation and use).
- a hydrogel is an example of a sustained- or controlled-delivery formulation.
- sustained-release preparations include semipermeable polymer matrices in the form of shaped articles, e.g. films, or microcapsules.
- Sustained release matrices can include polyesters, hydrogels, polylactides (U.S. Patent No. 3,773,919 and European Patent No. 0 058 481), copolymers of L-glutamic acid and gamma ethyl-L- glutamate (Sidman et al, 1983, Biopolymers 22: 547-56), poly(2-hydroxyethyl-methacrylate) (Langer et al, 1981, J. Biomed. Mater. Res. 15: 167-277 and Langer, 1982, Chem. Tech.
- Sustained-release compositions can also include liposomes, which can be prepared by any of several methods known in the art. See, e.g., Epstein et al, 1985, Proc. Natl. Acad. Sci. U.S.A. 82: 3688-92; and European Patent Nos. 0 036 676, 0 088 046, and 0 143 949.
- a GDF 15 polypeptide pharmaceutical composition to be used for in vivo administration typically should be sterile. This can be accomplished by filtration through sterile filtration membranes. Where the composition is lyophilized, sterilization using this method can be conducted either prior to, or following, lyophilization and reconstitution.
- the composition for parenteral administration can be stored in lyophilized form or in a solution.
- parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- the pharmaceutical composition can be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or as a dehydrated or lyophilized powder.
- Such formulations can be stored either in a ready-to-use form or in a form (e.g., lyophilized) requiring reconstitution prior to administration.
- kits for producing a single-dose administration unit can each contain both a first container having a dried protein and a second container having an aqueous formulation. Also included within the scope of this invention are kits containing single and multi-chambered pre-filled syringes (e.g., liquid syringes and lyosyringes).
- the effective amount of a GDF15 polypeptide pharmaceutical composition to be employed therapeutically will depend, for example, upon the therapeutic context and objectives.
- One skilled in the art will appreciate that the appropriate dosage levels for treatment will thus vary depending, in part, upon the molecule delivered, the indication for which a GDF15 polypeptide is being used, the route of administration, and the size (body weight, body surface, or organ size) and condition (the age and general health) of the patient. Accordingly, the clinician can titer the dosage and modify the route of administration to obtain the optimal therapeutic effect.
- a typical dosage can range from about 0.1 ⁇ g/kg to up to about 100 mg/kg or more, depending on the factors mentioned above.
- the dosage can range from 0.1 ⁇ g/kg up to about 100 mg/kg; or 1 ⁇ g/kg up to about 100 mg/kg; or 5 ⁇ g/kg, 10 ⁇ g/kg, 15 ⁇ g/kg, 20 ⁇ g/kg, 25 ⁇ g kg, 30 ⁇ g/kg, 35 ⁇ g/kg, 40 ⁇ g/kg, 45 ⁇ g/kg, 50 ⁇ g/kg, 55 ⁇ g/kg, 60 ⁇ g/kg, 65 ⁇ g/kg, 70 ⁇ g/kg, 75 ⁇ g/kg, up to about 100 mg/kg.
- the dosage can be 50 ⁇ g/kg, 100 ⁇ g/kg, 150 ⁇ g/kg, 200 ⁇ ⁇ ⁇ ⁇ , 250 ⁇ ⁇ ⁇ ⁇ , 300 ⁇ ⁇ ⁇ ⁇ , 350 ⁇ ⁇ ⁇ ⁇ , 400 ⁇ ⁇ ⁇ ⁇ , 450 ⁇ ⁇ ⁇ ⁇ , 500 ⁇ ⁇ ⁇ ⁇ , 550 ⁇ ⁇ ⁇ ⁇ , 600 ⁇ ⁇ ⁇ ⁇ , 650 ⁇ ⁇ ⁇ ⁇ , 700 ⁇ ⁇ ⁇ , 750 ⁇ ⁇ ⁇ ⁇ , 800 ⁇ ⁇ ⁇ ⁇ , 850 ⁇ ⁇ ⁇ ⁇ , 900 ⁇ ⁇ ⁇ ⁇ , 950 ⁇ ⁇ ⁇ ⁇ , 100 ⁇ ⁇ ⁇ ⁇ , 200 ⁇ ⁇ ⁇ ⁇ , 300 ⁇ ⁇ ⁇ ⁇ , 400 ⁇ ⁇ ⁇ ⁇ , 950 ⁇
- the frequency of dosing will depend upon the pharmacokinetic parameters of the GDF15 polypeptide in the formulation being used. Typically, a clinician will administer the composition until a dosage is reached that achieves the desired effect.
- the composition can therefore be administered as a single dose, as two or more doses (which may or may not contain the same amount of the desired molecule) over time, or as a continuous infusion via an implantation device or catheter. Further refinement of the appropriate dosage is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them. Appropriate dosages can be ascertained through use of appropriate dose-response data.
- the route of administration of the pharmaceutical composition is in accord with known methods, e.g., orally; through injection by intravenous, intraperitoneal, intracerebral (intraparenchymal), intracerebroventricular, intramuscular, intraocular, intraarterial, intraportal, or intralesional routes; by sustained release systems (which may also be injected); or by implantation devices.
- the compositions can be administered by bolus injection or continuously by infusion, or by implantation device.
- the composition can be administered locally via implantation of a membrane, sponge, or other appropriate material onto which the desired molecule has been absorbed or encapsulated.
- a membrane, sponge, or other appropriate material onto which the desired molecule has been absorbed or encapsulated.
- the device can be implanted into any suitable tissue or organ, and delivery of the desired molecule can be via diffusion, timed-release bolus, or continuous administration.
- a hydrogel comprising a polymer such as a gelatin (e.g., bovine gelatin, human gelatin, or gelatin from another source) or a naturally-occurring or a synthetically generated polymer can be employed. Any percentage of polymer (e.g., gelatin) can be employed in a hydrogel, such as 5, 10, 15 or 20%.
- a polymer such as a gelatin (e.g., bovine gelatin, human gelatin, or gelatin from another source) or a naturally-occurring or a synthetically generated polymer
- Any percentage of polymer e.g., gelatin
- the selection of an appropriate concentration can depend on a variety of factors, such as the therapeutic profile desired and the pharmacokinetic profile of the therapeutic molecule.
- polymers that can be incorporated into a hydrogel include polyethylene glycol (“PEG”), polyethylene oxide, polyethylene oxide-co-polypropylene oxide, co- polyethylene oxide block or random copolymers, polyvinyl alcohol, poly(vinyl pyrrolidinone), poly(amino acids), dextran, heparin, polysaccharides, polyethers and the like.
- PEG polyethylene glycol
- polyethylene oxide polyethylene oxide-co-polypropylene oxide
- co- polyethylene oxide block or random copolymers polyvinyl alcohol, poly(vinyl pyrrolidinone), poly(amino acids), dextran, heparin, polysaccharides, polyethers and the like.
- cross- linking can be achieved via a methacrylation reaction involving methacrylic anhydride.
- a high degree of cross-linking may be desirable while in other situations a lower degree of crosslinking is preferred.
- a higher degree of crosslinking provides a longer sustained release.
- a higher degree of crosslinking may provide a firmer hydrogel and a longer period over which drug is delivered.
- any ratio of polymer to crosslinking agent e.g., methacrylic anhydride
- the ratio of polymer to crosslinker can be, e.g., 8: 1, 16: 1, 24: 1, or 32: 1.
- the hydrogel polymer is gelatin and the crosslinker is methacrylate
- ratios of 8: 1, 16: 1, 24: 1, or 32: 1 methyacrylic anhydride: gelatin can be employed.
- GDF15 polypeptides can be used to treat, diagnose or ameliorate, a metabolic condition or disorder.
- the metabolic disorder to be treated is diabetes, e.g., type 2 diabetes mellitus.
- the metabolic condition or disorder is obesity.
- the metabolic condition or disorder is dyslipidemia, elevated glucose levels, elevated insulin levels or diabetic nephropathy.
- a metabolic condition or disorder that can be treated or ameliorated using a GDF15 polypeptide includes a state in which a human subject has a fasting blood glucose level of 100 mg/dL or greater, for example 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200 or greater than 200 mg/dL. Blood glucose levels can be determined in the fed or fasted state, or at random.
- the metabolic condition or disorder can also comprise a condition in which a subject is at increased risk of developing a metabolic condition. For a human subject, such conditions include a fasting blood glucose level of 100 mg/dL.
- Conditions that can be treated using a pharmaceutical composition comprising a GDF 15 polypeptide can also be found in the relevant literature, e.g., American Diabetes Association Standards of Medical Care in Diabetes Care-2011, American Diabetes Association, Diabetes Care Vol. 34, No. Supplement 1, SI 1-S61, 2010, incorporated herein by reference.
- a metabolic disorder or condition such as Type 2 diabetes, elevated glucose levels, elevated insulin levels, dyslipidemia, obesity or diabetic nephropathy
- a therapeutically effective dose of a GDF15 polypeptide e.g., a human GDF15 polypeptide such as SEQ ID NOs:2, 6 or 10
- the administration can be performed as described herein, such as by IV injection, intraperitoneal (IP) injection, subcutaneous injection, intramuscular injection, or orally in the form of a tablet or liquid formation.
- IP intraperitoneal
- a therapeutically effective or preferred dose of a GDF 15 polypeptide can be determined by a clinician.
- a therapeutically effective dose of GDF 15 polypeptide will depend, inter alia, upon the administration schedule, the unit dose of agent administered, whether the GDF15 polypeptide is administered in combination with other therapeutic agents, the immune status and the health of the recipient.
- the term "therapeutically effective dose,” as used herein, means an amount of GDF 15 polypeptide that elicits a biological or medicinal response in a tissue system, animal, or human being sought by a researcher, medical doctor, or other clinician, which includes alleviation or amelioration of the symptoms of the disease or disorder being treated, i.e., an amount of a GDF15 polypeptide that supports an observable level of one or more desired biological or medicinal response, for example lowering blood glucose, insulin, triglyceride, or cholesterol levels; reducing body weight; or improving glucose tolerance, energy expenditure, or insulin sensitivity.
- a therapeutically effective dose of a GDF15 polypeptide can also vary with the desired result.
- a dose of GDF15 will be correspondingly higher than a dose in which a comparatively lower level of blood glucose is desired.
- a dose of GDF 15 will be correspondingly lower than a dose in which a comparatively higher level of blood glucose is desired.
- a subject is a human having a blood glucose level of 100 mg/dL or greater can be treated with a GDF15 polypeptide.
- a method of the instant disclosure comprises first measuring a baseline level of one or more metabolically-relevant compounds such as glucose, insulin, cholesterol, lipid in a subject.
- a pharmaceutical composition comprising a GDF15 polypeptide is then administered to the subject.
- the level of the one or more metabolically-relevant compounds e.g., blood glucose, insulin, cholesterol, lipid
- the two levels can then be compared in order to determine the relative change in the metabolically-relevant compound in the subject.
- another dose of the pharmaceutical composition comprising a GDF15 molecule can be administered to achieve a desired level of one or more metabolically-relevant compound.
- a pharmaceutical composition comprising a GDF 15 polypeptide can be co-administered with another compound.
- identity and properties of compound coadministered with the GDF 15 polypeptide will depend on the nature of the condition to be treated or ameliorated.
- a non-limiting list of examples of compounds that can be administered in combination with a pharmaceutical compostion comprising a GDF 15 polypeptide include rosiglitizone, pioglitizone, repaglinide, nateglitinide, metformin, exenatide, stiagliptin, pramlintide, glipizide, glimeprirideacarbose, and miglitol.
- kits for practicing the disclosed methods can comprise a pharmaceutical composition such as those described herein, including nucleic acids encoding the peptides or proteins provided herein, vectors and cells comprising such nucleic acids, and pharmaceutical compositions comprising such nucleic acid-containing compounds, which can be provided in a sterile container.
- instructions on how to employ the provided pharmaceutical composition in the treatment of a metabolic disorder can also be included or be made available to a patient or a medical service provider.
- kits comprises (a) a pharmaceutical composition comprising a therapeutically effective amount of a GDF 15 polypeptide; and (b) one or more containers for the pharmaceutical composition.
- a kit can also comprise instructions for the use thereof; the instructions can be tailored to the precise metabolic disorder being treated.
- the instructions can describe the use and nature of the materials provided in the kit.
- kits include instructions for a patient to carry out administration to treat a metabolic disorder, such as elevated glucose levels, elevated insulin levels, obesity, type 2 diabetes, dyslipidemia or diabetic nephropathy.
- Instructions can be printed on a substrate, such as paper or plastic, etc, and can be present in the kits as a package insert, in the labeling of the container of the kit or components thereof (e.g., associated with the packaging), etc.
- the instructions are present as an electronic storage data file present on a suitable computer readable storage medium, e.g. CD-ROM, diskette, etc.
- the actual instructions are not present in the kit, but means for obtaining the instructions from a remote source, such as over the internet, are provided.
- An example of this embodiment is a kit that includes a web address where the instructions can be viewed and/or from which the instructions can be downloaded.
- kits are packaged in suitable packaging to maintain sterility.
- the components of a kit can be packaged in a kit containment element to make a single, easily handled unit, where the kit containment element, e.g., box or analogous structure, may or may not be an airtight container, e.g., to further preserve the sterility of some or all of the components of the kit.
- E. coli that were transformed with a GDF 15 expression vector constructed with an affinity tag were grown to an optical density of 9 at 600 nm and then induced and harvested at an optical density of 63 by centrifugation 6 hours later.
- Frozen cell paste was thawed and re-suspended into buffer at 15 % (wt./vol.) with a low shear homogenizer until the slurry was homogeneous.
- the cells were then subjected to high shear homogenization to break open and release product-containing inclusion bodies.
- the resulting homogenate was then centrifuged at 5,000 x g for an hour at 5 C to harvest the inclusion bodies as a pellet, leaving the cytoplasmic contaminants in the discarded supernatant.
- the residual cytoplasm is washed from the inclusion bodies by homogeneously re-suspending the pellet to the original homogenate volume using chilled water and a low shear homogenizer followed by centrifugation as before.
- the resulting pellet, washed inclusion bodies (WIBS) is then frozen at -80 C.
- a sufficient amount of WIBS and guanidine hydrochloride (GnHCl) was used at pH 8.5 in a reducing-solubilization to result in approximately 25 mg/ml reduced product and 6 M GnHCl final concentrations.
- the solubilization was then rapidly diluted 25-fold with stirring into a refolding buffer containing redox reagents, chaotrope and co-solvents at alkaline pH.
- the refold solution was allowed to gently stir and air oxidize at 6 C for 72 hours or until the solution was negative to Ellman's reagent.
- the refold solution at 5 C was then clarified by depth filtration to allow for a 10-fold ultra-filtration concentration and subsequent diafiltration into a buffer containing 50 mM sodium phosphate and low chaotrope concentration at pH 8.5.
- the subsequent retentate was warmed to 25 C and then the pH lowered into the acidic range to cause precipitation of contaminants.
- the precipitate was removed by centrifugation at 5,000 x g for 30 min at 25 C and the resulting supernatant further clarified by 0.45 um filtration.
- the filtrate (AP) was then adjusted to pH 8.5, and low salt concentration to permit the first step of purification involving immobilized metal affinity chromatography (IMAC).
- IMAC immobilized metal affinity chromatography
- the GDF 15 was purified using a two-step chromatography train.
- the adjusted AP was applied to an IMAC column that is equilibrated with buffered chaotrope containing a low salt concentration at pH 8.5.
- the column was next washed with equilibration buffer until a baseline ultraviolet (UV) level is obtained.
- Product and contaminants are eluted by step-wise increases in displacer concentration and the elutions were collected and subsequently assayed by Coomasie-stained SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) to identify which eluate fractions contained a polypeptide that migrates at the predicted molecular weight of GDF 15.
- the pooled fraction containing product is adjusted to pH 7.2 and 5 mM EDTA at 25 C.
- the product was converted into the mature length GDF 15 by adding a low concentration of an enzyme to cleave off the affinity tag at 25 C for several hours.
- the cleavage reaction mixture was adjusted with an organic modifier and acidic pH by the addition of acetic acid and organic solvent. This allowed for the final chromatography step consisting of a linear gradient elution of product from a reverse phase column conducted at 25 C.
- the elution from the chromatography was collected as fractions and then assayed by SDS-PAGE to determine the appropriate fractions to pool for homogeneous product.
- the resulting pool was buffer exchanged by diafiltration into a weakly acidic buffer, concentrated by ultra-filtration, sterile filtered, and stored at 5 C or frozen.
- Example 2 Example 2
- Liver and fat tissues are major metabolic organs in mammalians.
- a microarray study was conducted to compare gene expression patterns in liver and fat tissues of fed or fasted wildtype or obese ob/ob mice.
- Liver or epidydimal fat tissues were harvested for RNA extraction from age-matched C57B16 or ob/ob male mice (Jackson Labs) that had free access to food ("fed") or that were fasted for 24 hr ("fast”).cRNA samples were hybridized to custom made micro array chips (Agilent).
- Murine GDF15 SEQ ID NO:4; NCBI Accession Number BC067248.1 was identified as a target gene regulated by feeding/fasting in liver and fat tissues as well as differentially expressed in wildtype and ob/ob mice.
- FIG. 1A and IB shows the change of signal intensity of GDF15 in liver and fat tissues, respectively. It is noted that GDF15 expression levels are significantly higher in liver tissues from ob/ob mice than C57B1/6 mice. GDF15 expression levels were observed to be downregulated by fasting in liver in both C57B1/6 mice and ob/ob mice. GDF 15 expression levels were also significantly higher in fat tissues from ob/ob mice than C57B1/6 mice. Fasting increased GDF15 gene expression levels in both C57B1/6 mice and ob/ob mice. However, the fold induction was less robust in ob/ob mice. These data suggest that GDF 15 may be a novel metabolic regulator.
- PPARa is nuclear receptor regulating metabolism in liver and a major therapeutic target for metabolic disorders. PPARa is reported to be the master regulator mediating fasting-induced FGF21 upregulation in liver (Inagaki T 2007 Cell Metab 5:415-25). Male C57B16 mice (Jackson) were treated with a PPARa agonist clofibrate (500mg/kg), and liver tissues were harvested 1 day after treatment for RNA extraction. cRNA samples were hybridized to mouse 10K micro array (Motorola). Data was analyzed to identify PPARa target genes in mouse liver.
- Figure 2A shows that GDF15 expression was largely induced by clofibrate treatment in mouse liver and demonstrates that GDF15 is a downstream target gene of PPARa in liver.
- PPARy is a master regulator of gene expression in the fat tissue and PPARy agonists are clinically approved or being developed for diabetes treatment.
- Some PPARy target genes such as adiponectin, an adipokine and a PPARy target gene in the fat tissue (Maeda N 2001 Diabetes 50:2094-9), are also considered as therapeutic targets for treatment of type 2 diabetes.
- Gene expression patterns in 3T3-L1 adipocytes treated with vehicle or PPARy agonist BRL49653 were compared, and murine GDF15 was identified as a target gene inducible PPARy agonist treatment in adipocytes.
- 3T3-L1 adipocytes were treated with lOuM BRL49653 for 24 hours.
- RNA samples were isolated and cRNA samples were hybridized to mouse 10K micro array (Motorola).
- Data was analyzed to identify PPARy genes in 3T3-L1 adipocytes.
- Figure 2B shows that GDF15 expression was largely induced by BRL49653 treatment in 3T3-L1 mouse adipocytes and demonstrates that GDF15 is a downstream target gene of PPARy in adipocytes, suggesting that GDF 15 has the potential to be a therapeutic target for diabetes treatment.
- Murine GDF 15 Reduces Food Intake, Body Weight Gain, Blood Insulin Levels, Blood
- GDF 15 was robustly regulated by metabolic changes or pharmacological treatments that activate major pathways regulating metabolism, we examined if overexpression of GDF 15 in vivo would cause metabolic phenotypes in obese and diabetic ob/ob mice (Coleman DL 1973 Diabetologia 9:287-93).
- Adeno-associated virus (AAV) was used to achieve in vivo overexpression for two major advantages. First, unlike transgene, AAV can be applied to adult animals and does not interfere with fetal development. Secondly, unlike other types of virus used for in vivo gene overexpression, AAV produced with helper- free system is replication-defective and is not pathogenic (Matsushita T 1998 Gene Therapy 5: 938-45).
- muGDF 15 full-length cDNA (SEQ ID NO:3) was cloned into AAV vector with EF la promoter and bGH polyA.
- AAVs were produced with helper- free system and purified by chromatography and gradient centrifugation.
- Seven-week-old male ob/ob mice (Jackson Labs) were injected with 8x10 genomic copy/animal AAV-muGDF 15 or control virus through the tail vein.
- Glucose levels and body weight were examined on days 10, 17, 24, and 63 ( Figures 3 A and 3C, respectively). Food intake was measured weekly from day 3 to day 24 (Figure 3D). Blood insulin was also measured on day 17 ( Figure 3B). Total cholesterol (Figure 3E), free fatty acids (Fig 3F), triglyceride (Figure 3G), and insulin levels (Figure 3H) were measured on day 63.
- AAV-muGDF15 group compared to control virus treated group demonstrated that AAV mediated in vivo overexpression of muGDF15 largely corrected metabolic abnormalities in ob/ob mice, including hyperphagia, obesity, hyperglycemia, hyperinsulinemia and dyslipidemia.
- GDF15 regulates body metabolism and can be a potential therapeutic target for the treatment of a metabolic disorder, such as obesity, diabetes and dyslipidemia.
- Murine GDF15 Improves Hyperglycemia in Ob/Ob Mice, Independent of
- One group of control virus-injected mice had limited food access.
- the amount of food given to the pair- feeding group was calculated to be equal to the amount of food consumed by AAV-muGDF15 injected mice the day before (grams food intake/grams body weight), after normalized by body weight.
- Body weight and food intake were monitored daily, and the effect of GDF15 on these parameters is shown in Figures 4A and 4B, respectively.
- Glucose levels and body weight were measured at the end of the study and the effect of GDF15 on these parameters is shown in Figures 4C and 4D, respectively.
- the GDF 15 group had reduced food intake and body weight gain compared to control virus group, and the pair-fed group maintained similar body weight to the GDF15 group (Fig 4A and 4B).
- GDF 15 group had significantly lower glucose levels than both the control group and the pair-fed group, suggesting that GDF15 can improve glucose management in hyperglycemic ob/ob mice independently of food intake or body weight.
- the Efficacy of Murine GDF15 is More Robust in a High- fat Diet Induced Obesity (DIP) Model Than in a Normal Chow-fed Model
- mice fed normal chow were also included in the study.
- Glucose levels and body weight were measured on days 7, 13 and 28 by glucometer; the results are shown in Figures 5A and 5B, respectively. Food intake was measured weekly for four weeks and the results are shown in Figure 5C. The results for the control animals fed a normal chow diet are shown in Figures 5D-5F. AAV-muGDF15 largely decreased blood glucose levels and body weight in mice on high fat diet. On contrary, in mice on regular chow of normal blood glucose levels, the effect was very mild.
- GDF 15 is a metabolic regulator that takes effect selectively in the disease model, and will likely not cause hypoglycemia, unlike some diabetes therapies.
- Murine GDF 15 Improves Insulin Sensitivity and Glucose Tolerance in DIP Mice
- Diabetes is a metabolic disease of insulin resistance and insulin insufficiency.
- GDF 15 glucose tolerance and insulin sensitivity in mice fed high fat diet treated that had been administered with AAV- muGDF 15 or control virus.
- Male B6D2F1 mice (Harlan Labs) were fed a 60% high fat diet for three weeks and then injected with 8xl0 12 genomic copy/animal AAV-muGDF15 or control virus through the tail vein as described in Example 4.
- a glucose tolerance test (GTT) was performed three weeks after the AAV injection. The GTT was performed as follows: animals were fasted for 4 hours.
- FIGS. 6A and 6B show the glucose curve and insulin curve during the GTT, respectively.
- the GDF 15 group had lower glucose levels at all time points compared to control group ( Figure 6A), indicating that GDF 15 treated animals have improved glucose tolerance.
- the glucose-induced insulin secretion (GSIS) was also lower at all time points (Fig 6B), indicating that less insulin was required for glucose disposal after the oral glucose load, which suggests GDF15 treatment improved insulin sensitivity in these mice.
- an insulin sensitivity test (1ST) was performed two weeks after AAV injection on 4hr fasted mice; i.p. dosing of 0.5u/kg insulin was used.
- the insulin sensitivity test (1ST) was performed as follows: animals were fasted for 4 hours. Following measurement of body weight and glucose levels by glucometer, animals were i.p. dosed with lOml/kg of 0.5u/10ml Novolin solution. Glucose levels at 15, 30, 60, 120 min after glucose dosing were measured by glucometer.
- Figure 6C shows the glucose curve during 1ST.
- the GDF15 treated group had lower glucose at all time points compared to control group.
- Figure 6D shows the glucose levels normalized to basal glucose, and GDF15 treated group had lower glucose/basal glucose ratio at 30, 60, 90 min compared to control group, strongly indicating improved insulin sensitivity in GDF15 treated animals.
- glucose tolerance was tested in B6D2F1 DIO mice treated with AAV-huGDF15 or control virus.
- FIG. 7A depicts the results of the GTT. Food intake was measured every three days for 12 days.
- Figure 7B shows the results of the food intake measurement over the 12 day period.
- FIG. 7C depicts the results of the body weight measurements at the two week timepoint.
- FIG. 7D shows the amount of huGDF15 detected.
- the circulating GDF 15 levels in rodent are not clear due to lack of detection method. In normal humans, circulating GDF 15 levels are reported to be several hundred pg/ml (Moore AG, 2000 J Clin Endocrinol Metab 85: 4781-8). Our data shows that AAV-hGDF 15 treated group had several nanograms of huGDF15 in circulation ( Figure 7D).
- FIGS 9A- 9K Three weeks after AAV injection, urine glucose levels, urine albumin levels, urine volume, daily water intake, serum insulin levels, blood glucose levels, serum huGDF15 levels, body weight, and food intake were examined. The results are shown in Figures 9A- 9K ( Figure 9A shows urine glucose levels, 9B shows urine volume, 9C glucose excretion, 9D urine albumin, 9E albumin excretion, 9F water intake, 9G insulin levels, 9H glucose levels, 91 body weight, and 9 J food intake, and 9K huGDF15 levels. GDF 15 group had significantly improved glucosuria compared with control group, demonstrated with lowering of urine glucose levels (Fig 9A), urine volume (Fig 9B) and total glucose excretion (Fig 9C).
- GDF 15 group also reduced water intake to about 6ml/d/animal, which is similar to water intake of a normal animal, while water intake of control group was about 19ml/d/animal.
- Murine GDF 15 Reduces Fat Mass and Fat Mass/Total Body Mass Ratio in a DIO Model Since GDF 15 robustly reduced food intake and body weight gain in ob/ob and B6D2F1 DIO mice, body mass and fat mass were measured in B6D2F1 DIO mice after AAV-muGDF 15 injection to determine if GDF 15 mainly lowers body fat mass and may be useful as an obesity treatment or mainly lowers body lean mass, which would be undesired.
- Four- week-old male B6D2F1 mice Hard
- were put on 60% high fat diet or normal chow for 3 week then injected with 8xl0 12 genomic copy/animal AAV-muGDF 15 or control virus through tail vein as described in Example 4.
- body mass and fat mass were measured in B6D2F 1 DIO mice after AAV-huGDF15 injection.
- Male B6D2F1 mice (Harlan Labs) were put on 60% high fat diet for five months, then injected with 8xl0 12 genomic copy/animal AAV-huGDF15 or control virus through tail vein as described in Example 4.
- mice Six-week-old male ob/ob mice (Jackson Labs) were dosed subcutaneously with 5mg/kg rmGDF 15 protein or vehicle buffer twice per day. Briefly, ob/ob male mice were randomized by food intake, body weight and glucose levels into vehicle and treatment group. Animals were subcutaneously dosed twice daily with 5mg/kg recombinant muGDF15 protein or vehicle buffer for 2 days.
- Glucose, body weight, food intake before injection and on days 1 and 2 were measured. For all timepoints, the glucose levels are shown in Figure 12A, body weight is shown in Figure 12B and food intake is shown in Figure 12C.
- mice Seven-week-old male ob/ob mice (Jackson Labs) were dosed subcutaneously with 5, 1.5, 0.5, 0.15 mg/kg rhGDF15 protein or vehicle buffer, by single injection. Animals were randomized as described in Example 13.
- Glucose, body weight, food intake were measured 16-17 hours after treatment. Glucose levels are shown in Figure 13 A, food intake is shown in Figure 13B and body weight is shown in Figure 13C.
- the data indicates that exogenously administered recombinant human GDF15 protein acutely improves hyperphagia and hyperglycemia in ob/ob mice, and the efficacy was dose-dependent.
- mice Male B6D2F1 mice (Harlan Labs) on 60% high fat diet for six months were dosed subcutaneously with 5mg/kg rhGDF15 protein or vehicle buffer by single dosing, animals were randomized as described in Example 13.
- GTT glucose tolerance test
- GDF 15 acutely improves lipid tolerance in mice.
- Serum triglyceride levels were measured at 0, 60, 90, 120, 180 min after lipid challenge by a colorimetric assay (Sigma). The measured serum triglyceride levels are presented in Figure 15A. Serum rhGDF15 levels at 180 min were measured by huGDF 15 ELISA (R&D Systems) and are shown in Figure 15B.
- Serum triglyceride levels increased at 30, 60, 90 min after oral intralipid challenge in both GDF 15 and vehicle treated animals (Figure 15 A). However, the triglyceride levels at 60 and 90 min were significantly lower in treated group, indicating that GDF 15 acutely improved lipid tolerance in these animals ( Figure 15A).
- Dyslipidemia including hypertriglycerdeamia is a major risk factor for cardiovascular disease, the leading outcome that causes mortality in diabetes patients (Hokanson JE 1996 J. Cardiovasc. Risk 3:213-219).
- the acute improvement of lipid tolerance by GDF 15 suggests that GDF 15 can provide a beneficial effect in diabetic dyslipidemia, particularly postprandial dyslipidemia.
- Murine GDF 15 Improves the Insulin and Lipid Profile in a DIO Model
- GDF 15 acutely improves lipid tolerance, we also examined if chronically, GDF 15 improves blood lipid profiles.
- B6D2F1 mice (Harlan Labs) were put on 60% high fat diet and injected with 8xl0 12 genomic copy/animal AAV-muGDF15 or control virus through tail vein as described in Example 4. Blood insulin, total cholesterol, NEFA and triglyceride levels were measured 3 weeks after AAV injection. The results are shown in Figure 16; Figure 16A shows insulin levels, Figure 16B NEFA levels, Figure 16C total cholesterol levels, and Figure 16D triglyceride levels.
- GDF15 group had lower cholesterol levels (Fig 16C) and triglyceride levels compared to control group, demonstrating that GDF 15 chronically improves lipid profile. This data further indicates that GDF15 treatment can provide a beneficial effect in diabetic dyslipidemia.
Abstract
Description
Claims
Priority Applications (8)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
MX2013011726A MX343729B (en) | 2011-04-08 | 2012-04-05 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15). |
US14/009,790 US10752664B2 (en) | 2011-04-08 | 2012-04-05 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (GDF-15) |
JP2014504005A JP5977814B2 (en) | 2011-04-08 | 2012-04-05 | Method for treating or ameliorating metabolic disorders using growth differentiation factor 15 (GDF-15) |
EP12761825.4A EP2694092B1 (en) | 2011-04-08 | 2012-04-05 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) |
AU2012240102A AU2012240102C1 (en) | 2011-04-08 | 2012-04-05 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (GDF-15) |
CN201280017293.3A CN103533951B (en) | 2011-04-08 | 2012-04-05 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (GDF-15) |
CA2832581A CA2832581C (en) | 2011-04-08 | 2012-04-05 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) |
US16/918,088 US20200325200A1 (en) | 2011-04-08 | 2020-07-01 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201161473583P | 2011-04-08 | 2011-04-08 | |
US61/473,583 | 2011-04-08 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/009,790 A-371-Of-International US10752664B2 (en) | 2011-04-08 | 2012-04-05 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (GDF-15) |
US16/918,088 Continuation US20200325200A1 (en) | 2011-04-08 | 2020-07-01 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) |
Publications (3)
Publication Number | Publication Date |
---|---|
WO2012138919A2 true WO2012138919A2 (en) | 2012-10-11 |
WO2012138919A3 WO2012138919A3 (en) | 2013-01-17 |
WO2012138919A9 WO2012138919A9 (en) | 2013-03-07 |
Family
ID=46881141
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2012/032415 WO2012138919A2 (en) | 2011-04-08 | 2012-04-05 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) |
Country Status (8)
Country | Link |
---|---|
US (2) | US10752664B2 (en) |
EP (1) | EP2694092B1 (en) |
JP (1) | JP5977814B2 (en) |
CN (1) | CN103533951B (en) |
AU (1) | AU2012240102C1 (en) |
CA (1) | CA2832581C (en) |
MX (1) | MX343729B (en) |
WO (1) | WO2012138919A2 (en) |
Cited By (39)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2014120619A3 (en) * | 2013-01-30 | 2014-09-25 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use in treating metabolic disorders |
US9089525B1 (en) | 2011-07-01 | 2015-07-28 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject |
US9161966B2 (en) | 2013-01-30 | 2015-10-20 | Ngm Biopharmaceuticals, Inc. | GDF15 mutein polypeptides |
WO2015198199A1 (en) * | 2014-06-23 | 2015-12-30 | Novartis Ag | Hsa-gdf-15 fusion polypeptide and use thereof. |
US9550819B2 (en) | 2012-03-27 | 2017-01-24 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
WO2017109706A1 (en) | 2015-12-22 | 2017-06-29 | Novartis Ag | Methods of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) |
US9834586B2 (en) | 2014-07-30 | 2017-12-05 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US9862752B2 (en) | 2013-07-31 | 2018-01-09 | Amgen Inc. | Growth differentiation factor 15 (GDF-15) constructs |
US9878008B2 (en) | 2012-12-27 | 2018-01-30 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having bile acid diarrhea or bile acid malabsorption |
US9920118B2 (en) | 2014-10-31 | 2018-03-20 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US9925242B2 (en) | 2012-12-27 | 2018-03-27 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of nonalcoholic steatohepatitis |
WO2018071493A1 (en) * | 2016-10-12 | 2018-04-19 | Janssen Biotech, Inc. | Methods for screening for modulators of gdf15-like biological activity |
US9963494B2 (en) | 2012-11-28 | 2018-05-08 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject |
WO2018102854A1 (en) * | 2016-12-06 | 2018-06-14 | St Vincent's Hospital Sydney Limited | Treatment of obesity and eating disorders |
US10093735B2 (en) | 2014-01-24 | 2018-10-09 | Ngm Biopharmaceuticals, Inc. | Beta-klotho binding proteins |
CN108700573A (en) * | 2016-02-29 | 2018-10-23 | 公立大学法人横滨市立大学 | Detect the method and detection reagent of castration-resistant prostate cancer |
US10174119B2 (en) | 2016-03-31 | 2019-01-08 | Ngm Biopharmaceuticals, Inc. | Binding proteins and methods of use thereof |
WO2019048660A1 (en) | 2017-09-10 | 2019-03-14 | Novo Nordisk A/S | Mic-1 and glp-1 for use in the treatment of obesity |
US10336798B2 (en) | 2012-01-26 | 2019-07-02 | Amgen Inc. | Growth differentiation factor 15 (GDF-15) polypeptides |
US10369199B2 (en) | 2013-10-28 | 2019-08-06 | Ngm Biopharmaceuticals, Inc. | Methods of using variants of FGF19 polypeptides for the treatment of cancer |
US10398758B2 (en) | 2014-05-28 | 2019-09-03 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions |
US10398782B2 (en) | 2017-05-23 | 2019-09-03 | Novo Nordisk A/S | MIC-1 compounds and uses thereof |
US10434144B2 (en) | 2014-11-07 | 2019-10-08 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders |
US10456449B2 (en) | 2014-06-16 | 2019-10-29 | Ngm Biopharmaceuticals, Inc. | Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
US10517929B2 (en) | 2014-10-23 | 2019-12-31 | Ngm Biopharmaceuticals, Inc. | Pharmaceutical compositions comprising FGF19 variants |
WO2020031149A2 (en) | 2018-08-10 | 2020-02-13 | Novartis Ag | Gfral extracellular domains and methods of use |
US10588980B2 (en) | 2014-06-23 | 2020-03-17 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
US10744185B2 (en) | 2015-11-09 | 2020-08-18 | Ngm Biopharmaceuticals, Inc. | Methods of using variants of FGF19 polypeptides for the treatment of pruritus |
US10752664B2 (en) | 2011-04-08 | 2020-08-25 | Amgen Inc. | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (GDF-15) |
US10800843B2 (en) | 2015-07-29 | 2020-10-13 | Ngm Biopharmaceuticals, Inc. | Beta klotho-binding proteins |
US11066454B2 (en) | 2012-11-28 | 2021-07-20 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants and fusions of FGF19 polypeptides |
US11161889B2 (en) | 2018-04-09 | 2021-11-02 | Amgen Inc. | Growth differentiation factor 15 fusion proteins |
US11279702B2 (en) | 2020-05-19 | 2022-03-22 | Kallyope, Inc. | AMPK activators |
US11370841B2 (en) | 2016-08-26 | 2022-06-28 | Ngm Biopharmaceuticals, Inc. | Methods of treating fibroblast growth factor 19-mediated cancers and tumors |
US11407768B2 (en) | 2020-06-26 | 2022-08-09 | Kallyope, Inc. | AMPK activators |
WO2022219495A1 (en) | 2021-04-12 | 2022-10-20 | Novartis Ag | 2-((4-((s)-2-(4-chloro-2-fluorophenyl)-2-methylbenzo[d][1,3]dioxol-4-yl)piperidin-1-yl)methyl)-1-(((s)-oxetan-2-yl)methyl)-1h-imidazole derivatives as activators of the glp1 receptor for the treatment of obesity |
US11512065B2 (en) | 2019-10-07 | 2022-11-29 | Kallyope, Inc. | GPR119 agonists |
WO2023154953A1 (en) | 2022-02-14 | 2023-08-17 | Ngm Biopharmaceuticals, Inc. | Gdf15 polypeptides for treating and preventing autoimmune diseases |
WO2023152698A1 (en) | 2022-02-10 | 2023-08-17 | Novartis Ag | 2-((4-((s)-2-(4-chloro-2-fluorophenyl)-2-methylbenzo[d][1,3]dioxol-4-yl)piperidin-1-yl)methyl)-1-(((s)-oxetan-2-yl)methyl)-1h-imidazole derivatives as activators of the glp1 receptor for the treatment of obesity |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2015200080A1 (en) * | 2014-06-23 | 2015-12-30 | Novartis Ag | Site specific protein modifications |
CN108697795A (en) * | 2016-02-29 | 2018-10-23 | 伊莱利利公司 | Gfral receptor therapies |
CN116925237A (en) | 2019-12-31 | 2023-10-24 | 北京质肽生物医药科技有限公司 | Fusion proteins of GLP-1 and GDF15 and conjugates thereof |
CN115244076B (en) | 2020-10-27 | 2023-08-04 | 北京质肽生物医药科技有限公司 | GDF15 fusion proteins and uses thereof |
Citations (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
EP0088046A2 (en) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipids in the aqueous phase |
EP0133988A2 (en) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulating peptide-containing pharmaceutical preparations with retarded release, and process for their preparation |
EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
WO1993015722A1 (en) | 1992-02-07 | 1993-08-19 | Syntex (Usa) Inc. | Controlled delivery of pharmaceuticals from preformed porous microparticles |
WO1994020069A1 (en) | 1993-03-08 | 1994-09-15 | Amgen Inc. | Pulmonary administration of granulocyte colony stimulating factor |
Family Cites Families (50)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ZA811368B (en) | 1980-03-24 | 1982-04-28 | Genentech Inc | Bacterial polypedtide expression employing tryptophan promoter-operator |
AU8591198A (en) | 1997-07-31 | 1999-02-22 | Johns Hopkins University School Of Medicine, The | Growth differentiation factor-15 |
SK9432001A3 (en) | 1999-01-07 | 2003-02-04 | Lexigen Pharm Corp | Expression and export of anti-obesity proteins as Fc fusion proteins |
US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
US20030103978A1 (en) | 2000-02-23 | 2003-06-05 | Amgen Inc. | Selective binding agents of osteoprotegerin binding protein |
EP1395605B8 (en) | 2001-03-09 | 2014-12-17 | Iterative Therapeutics, Inc. | Polymeric immunoglobulin fusion proteins that target low-affinity fcgamma receptors |
JP4422949B2 (en) | 2001-06-26 | 2010-03-03 | 武田薬品工業株式会社 | TGF-β superfamily production / secretion promoter |
US7332474B2 (en) | 2001-10-11 | 2008-02-19 | Amgen Inc. | Peptides and related compounds having thrombopoietic activity |
US7101852B2 (en) * | 2003-05-30 | 2006-09-05 | The Board Of Regents Of The University Of Texas System | Composition and method for treatment and prevention of restenosis |
WO2005063815A2 (en) | 2003-11-12 | 2005-07-14 | Biogen Idec Ma Inc. | Fcϝ receptor-binding polypeptide variants and methods related thereto |
EP1682584B1 (en) | 2003-11-13 | 2013-04-17 | Hanmi Science Co., Ltd. | A pharmaceutical composition comprising an immunoglobulin fc region as a carrier |
WO2005077981A2 (en) | 2003-12-22 | 2005-08-25 | Xencor, Inc. | Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES |
EP2774620A1 (en) | 2004-04-13 | 2014-09-10 | St Vincent's Hospital Sydney Limited | Method for modulating weight loss |
US7670595B2 (en) | 2004-06-28 | 2010-03-02 | Merck Patent Gmbh | Fc-interferon-beta fusion proteins |
EP1931709B1 (en) | 2005-10-03 | 2016-12-07 | Xencor, Inc. | Fc variants with optimized fc receptor binding properties |
CN1974601A (en) | 2005-11-28 | 2007-06-06 | 上海新生源医药研究有限公司 | New-type Fc fusion protein and its production process |
CN101854947A (en) * | 2007-08-16 | 2010-10-06 | 圣文森特医院悉尼有限公司 | Be used to regulate active medicament of macrophage inhibition factor (MIC-1) and method |
PT2235064E (en) | 2008-01-07 | 2016-03-01 | Amgen Inc | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
EP2279419A1 (en) | 2008-05-20 | 2011-02-02 | Roche Diagnostics GmbH | Gdf-15 as biomarker in type 1 diabetes |
BRPI0916904A2 (en) | 2008-08-04 | 2016-10-11 | Fiveprime Therapeutics Inc | polypeptides, ecd fgfr4 fusion molecules, pharmaceutical compositions, polynucleotide and methods of treating angiogenic disorder, patient cancer and patient macular degeneration and their uses |
WO2010048670A1 (en) | 2008-10-31 | 2010-05-06 | St Vincent's Hospital Sydney Limited | Method of prognosis in chronic kidney disease |
JP2013511281A (en) | 2009-11-23 | 2013-04-04 | アムジェン インコーポレイテッド | Monomeric antibody Fc |
WO2011064758A2 (en) | 2009-11-30 | 2011-06-03 | Pfizer Limited | Fusion protein |
JP2013512672A (en) | 2009-12-02 | 2013-04-18 | アムジエン・インコーポレーテツド | Human FGFR1c, human β-croto-, and binding proteins that bind to both human FGFR1c and human β-croto- |
US8362210B2 (en) | 2010-01-19 | 2013-01-29 | Xencor, Inc. | Antibody variants with enhanced complement activity |
ES2526541T3 (en) | 2010-07-12 | 2015-01-13 | Pfizer Limited | N-sulfonylbenzamides as voltage dependent sodium channel inhibitors |
EP2593431B1 (en) | 2010-07-12 | 2014-11-19 | Pfizer Limited | N-sulfonylbenzamides as inhibitors of voltage-gated sodium channels |
CA2804716A1 (en) | 2010-07-12 | 2012-01-19 | Pfizer Limited | Chemical compounds |
EP2796874B1 (en) | 2010-08-26 | 2017-03-08 | Roche Diagnostics GmbH | Use of biomarkers in monitoring a medication in a subject suffering from heart failure |
EP2439535A1 (en) | 2010-10-07 | 2012-04-11 | F. Hoffmann-La Roche AG | Diagnosis of diabetes related heart disease and GDF-15 and Troponin as predictors for the development of type 2 diabetes mellitus |
AU2011325833C1 (en) | 2010-11-05 | 2017-07-13 | Zymeworks Bc Inc. | Stable heterodimeric antibody design with mutations in the Fc domain |
JP5972915B2 (en) | 2011-03-16 | 2016-08-17 | アムジエン・インコーポレーテツド | Fc variant |
CN103533951B (en) | 2011-04-08 | 2017-04-19 | 安姆根有限公司 | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (GDF-15) |
EA201892619A1 (en) | 2011-04-29 | 2019-04-30 | Роше Гликарт Аг | IMMUNOCONJUGATES CONTAINING INTERLEUKIN-2 MUTANT POLYPETIPS |
US9714276B2 (en) | 2012-01-26 | 2017-07-25 | Amgen Inc. | Growth differentiation factor 15 (GDF-15) polypeptides |
WO2013148117A1 (en) | 2012-03-27 | 2013-10-03 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
MX360109B (en) | 2012-04-20 | 2018-10-23 | Merus Nv | Methods and means for the production of ig-like molecules. |
DK2934584T3 (en) | 2012-12-21 | 2020-05-18 | Aveo Pharmaceuticals Inc | ANTI-GDF15 ANTIBODIES |
EA202092386A1 (en) | 2013-07-31 | 2021-04-30 | Эмджен Инк. | CONSTRUCTIONS BASED ON DIFFERENTIATION AND GROWTH FACTOR 15 (GDF15) |
WO2015200080A1 (en) | 2014-06-23 | 2015-12-30 | Novartis Ag | Site specific protein modifications |
US10588980B2 (en) | 2014-06-23 | 2020-03-17 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
US20170204149A1 (en) | 2014-06-23 | 2017-07-20 | Novartis Ag | Hsa-gdf-15 fusion polypeptide and use thereof |
US9272019B2 (en) | 2014-06-24 | 2016-03-01 | Novo Nordisk A/S | MIC-1 fusion proteins and uses thereof |
US20190000923A1 (en) | 2015-12-22 | 2019-01-03 | Novartis Ag | Methods of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) |
US11105818B2 (en) | 2016-01-15 | 2021-08-31 | Novo Nordisk A/S | MIC-1 receptor and uses thereof |
CN108697795A (en) | 2016-02-29 | 2018-10-23 | 伊莱利利公司 | Gfral receptor therapies |
EP3423097A4 (en) | 2016-03-04 | 2019-08-21 | NGM Biopharmaceuticals, Inc. | Compositions and methods for modulating body weight |
US10336812B2 (en) | 2016-05-10 | 2019-07-02 | Janssen Biotech, Inc. | GDF15 fusion proteins and uses thereof |
US20190248852A1 (en) | 2016-05-24 | 2019-08-15 | Novo Nordisk A/S | MIC-1 Compounds and Use Thereof |
TWI724392B (en) | 2018-04-06 | 2021-04-11 | 美商美國禮來大藥廠 | Growth differentiation factor 15 agonist compounds and methods of using the same |
-
2012
- 2012-04-05 CN CN201280017293.3A patent/CN103533951B/en active Active
- 2012-04-05 US US14/009,790 patent/US10752664B2/en active Active
- 2012-04-05 JP JP2014504005A patent/JP5977814B2/en active Active
- 2012-04-05 MX MX2013011726A patent/MX343729B/en active IP Right Grant
- 2012-04-05 EP EP12761825.4A patent/EP2694092B1/en not_active Revoked
- 2012-04-05 WO PCT/US2012/032415 patent/WO2012138919A2/en active Application Filing
- 2012-04-05 AU AU2012240102A patent/AU2012240102C1/en active Active
- 2012-04-05 CA CA2832581A patent/CA2832581C/en active Active
-
2020
- 2020-07-01 US US16/918,088 patent/US20200325200A1/en not_active Abandoned
Patent Citations (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
EP0088046A2 (en) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipids in the aqueous phase |
EP0133988A2 (en) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulating peptide-containing pharmaceutical preparations with retarded release, and process for their preparation |
EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
WO1993015722A1 (en) | 1992-02-07 | 1993-08-19 | Syntex (Usa) Inc. | Controlled delivery of pharmaceuticals from preformed porous microparticles |
WO1994020069A1 (en) | 1993-03-08 | 1994-09-15 | Amgen Inc. | Pulmonary administration of granulocyte colony stimulating factor |
Non-Patent Citations (61)
Title |
---|
"American Diabetes Association Standards of Medical Care in Diabetes Care-2011", vol. 34, 2010, AMERICAN DIABETES ASSOCIATION, DIABETES CARE, pages: SL 1 - S61 |
"EXTEMPORANEOUS ORAL LIQUID DOSAGE PREPARATIONS", 1998, CSHP |
ANSEL ET AL.: "PHARMACEUTICAL DOSAGE FORMS & DRUG DELIVERY SYSTEMS(7th ed.", 2000 |
AULTON: "PHARMACEUTICS: THE SCIENCE OF DOSAGE FORM DESIGN", 1988, CHURCHILL LIVINGSTONE |
AUSUBEL ET AL.,: "Current Protocols in Molecular Biology", 1994, GREEN PUBLISHERS INC. AND WILEY AND SONS |
BAEK SJ, GASTROENTEROLOGY, vol. 131, 2006, pages 1553 - 60 |
BAEK SJ, JBIOL CHEM., vol. 276, 2001, pages 33384 - 92 |
BAUSKIN AR, EIWBO J., vol. 19, 2000, pages 2212 - 20 |
BERGE ET AL., J. PHARM. SCI., vol. 6661, 1977, pages 1 - 19 |
BOOTCOV MR, PROC NATL ACAD SCI, vol. 94, 1997, pages 11514 - 9 |
BOOTCOV MR, PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 11514 - 9 |
BOTTNER M, GENE, vol. 237, 1999, pages 105 - 11 |
CARILLO ET AL., SIAM J. APPLIED MATH., vol. 48, 1988, pages 1073 |
CEKANOVA M, CANCER PREV RES, vol. 2, 2009, pages 450 - 8 |
COLEMAN DL, DIABETOLOGIA, vol. 9, 1973, pages 287 - 93 |
CREIGHTON: "PROTEINS: STRUCTURE AND MOLECULAR PROPERTIES(2d Ed.)", 1984, W.H. FREEMAN AND COMPANY |
DAYHOFF ET AL.: "Atlas of Protein Sequence and Structure", vol. 5, 1978, pages: 345 - 352 |
DEVEREUX ET AL., NUCL. ACID RES., vol. 12, 1984, pages 387 |
EPSTEIN ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 82, 1985, pages 3688 - 92 |
FAIRLIE WD, GENE, vol. 254, 2000, pages 67 - 76 |
FREIBERG; ZHU, INT. J. PHARM., vol. 282, 2004, pages 1 - 18 |
GENNARO: "REMINGTON: THE SCIENCE AND PRACTICE OF PHARMACY, 19th edition,", 1995 |
GOODMAN AND GILMAN: "The Pharmacological Basis Of Therapeutics(9th ed.", 1996 |
GRIBSKOV, M. AND DEVEREUX, J.,: "Sequence Analysis Primer", 1991, M. STOCKTON PRESS |
GRIFFIN, A. M., AND GRIFFIN, H. G.,: "Computer Analysis of Sequence Data. Part I", 1994, HUMANA PRESS |
HENIKOFF ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 89, 1992, pages 10915 - 10919 |
HOKANSON JE, J. CARDIOVASC. RISK, vol. 3, 1996, pages 213 - 219 |
HROMAS R, BIOCHIM BIOPHYS ACTA, vol. 1354, 1997, pages 40 - 4 |
INAGAKI T, CELL METAB, vol. 5, 2007, pages 415 - 25 |
IWATSUKA H, ENDOCRINOL JPN, vol. 17, 1970, pages 23 - 35 |
JOHNEN H, NAT MED., vol. 11, 2007, pages 1333 - 40 |
KARASAWA H, METAB CLIN EXP, vol. 58, 2009, pages 296 - 33 |
KATOH M, INTJMOIMED, vol. 17, 2006, pages 951 - 5 |
KEMPF T, CIRC RES., vol. 98, 2006, pages 351 - 60 |
LANGER ET AL., J BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
LAWTON LN, GENE, vol. 203, 1997, pages 17 - 26 |
LESK, A. M.,: "Computational Molecular Biology", 1988, OXFORD UNIVERSITY PRESS |
LIEBERMAN ET AL.: "PHARMACEUTICAL DOSAGE FORMS-DISPERSE SYSTEMS(2nd ed.,", vol. 3, 1998 |
MAEDA N, DIABETES, vol. 50, 2001, pages 2094 - 9 |
MARTINDALE: "Remington's PHARMACEUTICAL SCIENCES(31st edition),", article "THE EXTRA PHARMACOPEIA" |
MATSUSHITA T, GENE THERAPY, vol. 5, 1998, pages 938 - 45 |
MOORE AG, J CLIN ENDOCRINOL METAB, vol. 85, 2000, pages 4781 - 4788 |
MOORE AG, J CLIN ENDOCRINOL METAB, vol. 85, 2000, pages 4781 - 8 |
NEEDLEMAN ET AL., J. MOL. BIOL., vol. 48, 1970, pages 443 - 453 |
PARALKAR VM, J BIOL CHEM., vol. 273, 1998, pages 13760 - 7 |
REDDI AS, ADV EXP MED BIOL, vol. 246, 1988, pages 7 - 15 |
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
SAMBROOK, J.; FRITSH, E. F.; MANIATIS, T.: "Molecular Cloning: A Laboratory Manual 2nd, ed.,", 1989, COLD SPRING HARBOR LABORATORY PRESS |
See also references of EP2694092A2 |
SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 - 56 |
SMITH, D. W.,: "Biocomvuting Informatics and Genome Projects", 1993, ACADEMIC PRESS |
STRELAU J, J NEUROSCI., vol. 29, 2009, pages 13640 - 8 |
TAMARY H, BLOOD, vol. 112, 2008, pages 5241 - 4 |
TANNO T, NAT MED, vol. 13, 2007, pages 1096 - 101 |
VAN HEEKE; SCHUSTER, J. BIOL. CHEM., vol. 264, 1989, pages 5503 - 5509 |
VON HEINJE, G.: "Sequence Analysis in Molecular Biology", 1987, ACADEMIC PRESS |
WILSON; GISVOLDS: "TEXTBOOK OF ORGANIC MEDICINAL AND PHARMACEUTICAL CHEMISTRY(10th ed.,", 1998 |
WISCHKE; SCHWENDEMAN, INT. J. PHARM., vol. 364, 2008, pages 298 - 327 |
XU J, CIRC RES., vol. 98, 2006, pages 342 - 50 |
ZIMMERMANN MB, AM J CLIN NUTR, vol. 88, 2008, pages 1026 - 31 |
Cited By (80)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10752664B2 (en) | 2011-04-08 | 2020-08-25 | Amgen Inc. | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (GDF-15) |
US9089525B1 (en) | 2011-07-01 | 2015-07-28 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject |
US11065302B2 (en) | 2011-07-01 | 2021-07-20 | Ngm Biopharmaceuticals, Inc. | Compositions comprising fusion variants of FGF19 polypeptides |
US9580483B2 (en) | 2011-07-01 | 2017-02-28 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of diabetes |
US9670260B2 (en) | 2011-07-01 | 2017-06-06 | Ngm Biopharmaceuticals, Inc. | Compositions comprising fusion variants of FGF19 polypeptides |
US9751924B2 (en) | 2011-07-01 | 2017-09-05 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising fusion variants of FGF19 polypeptides for reducing glucose levels in a subject |
US10413590B2 (en) | 2011-07-01 | 2019-09-17 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants of FGF19 polypeptides for reducing body mass in a subject |
US10336798B2 (en) | 2012-01-26 | 2019-07-02 | Amgen Inc. | Growth differentiation factor 15 (GDF-15) polypeptides |
US11739131B2 (en) | 2012-01-26 | 2023-08-29 | Amgen Inc. | Growth differentiation factor 15 (GDF-15) polypeptides |
US9550819B2 (en) | 2012-03-27 | 2017-01-24 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US10869909B2 (en) | 2012-03-27 | 2020-12-22 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US10195250B2 (en) | 2012-03-27 | 2019-02-05 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US9963494B2 (en) | 2012-11-28 | 2018-05-08 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for reducing glucose levels in a subject |
US11066454B2 (en) | 2012-11-28 | 2021-07-20 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants and fusions of FGF19 polypeptides |
US10758590B2 (en) | 2012-11-28 | 2020-09-01 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF 19 polypeptides for treating diabetes |
US11564972B2 (en) | 2012-12-27 | 2023-01-31 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants of FGF19 polypeptides for treating primary biliary cirrhosis in a subject |
US9878009B2 (en) | 2012-12-27 | 2018-01-30 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having error of bile acid synthesis |
US9889177B2 (en) | 2012-12-27 | 2018-02-13 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having primary sclerosing cholangitis |
US9889178B2 (en) | 2012-12-27 | 2018-02-13 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having nonalcoholic steatohepatitis |
US9895416B2 (en) | 2012-12-27 | 2018-02-20 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having cholestasis |
US11103554B2 (en) | 2012-12-27 | 2021-08-31 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants of FGF19 polypeptides for reducing bile acid synthesis in a subject having cirrhosis |
US9925242B2 (en) | 2012-12-27 | 2018-03-27 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for treatment of nonalcoholic steatohepatitis |
US9878008B2 (en) | 2012-12-27 | 2018-01-30 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having bile acid diarrhea or bile acid malabsorption |
US9974833B2 (en) | 2012-12-27 | 2018-05-22 | Ngm Biopharmaceuticals, Inc. | Methods of using compositions comprising variants and fusions of FGF19 polypeptides for modulating bile acid homeostasis in a subject having pregnancy intrahepatic cholestasis |
US10323075B2 (en) | 2013-01-30 | 2019-06-18 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US9828415B2 (en) | 2013-01-30 | 2017-11-28 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
WO2014120619A3 (en) * | 2013-01-30 | 2014-09-25 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use in treating metabolic disorders |
US10610568B2 (en) | 2013-01-30 | 2020-04-07 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US9827291B2 (en) | 2013-01-30 | 2017-11-28 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US9161966B2 (en) | 2013-01-30 | 2015-10-20 | Ngm Biopharmaceuticals, Inc. | GDF15 mutein polypeptides |
TWI648401B (en) * | 2013-07-31 | 2019-01-21 | 安美基公司 | Growth Differentiation Factor 15 (GDF-15) Construct |
US9862752B2 (en) | 2013-07-31 | 2018-01-09 | Amgen Inc. | Growth differentiation factor 15 (GDF-15) constructs |
US10894814B2 (en) | 2013-07-31 | 2021-01-19 | Amgen Inc. | Growth differentiation factor 15 (GDF-15) constructs |
KR102616674B1 (en) * | 2013-07-31 | 2023-12-29 | 암젠 인크 | Growth differentiation factor 15 (gdf-15) constructs |
JP2021113219A (en) * | 2013-07-31 | 2021-08-05 | アムジエン・インコーポレーテツド | Growth differentiation factor 15 (gdf-15) constructs |
KR20220038829A (en) * | 2013-07-31 | 2022-03-29 | 암젠 인크 | Growth differentiation factor 15 (gdf-15) constructs |
JP2019178132A (en) * | 2013-07-31 | 2019-10-17 | アムジエン・インコーポレーテツド | Growth differentiation factor 15 (gdf-15) constructs |
US10369199B2 (en) | 2013-10-28 | 2019-08-06 | Ngm Biopharmaceuticals, Inc. | Methods of using variants of FGF19 polypeptides for the treatment of cancer |
US10093735B2 (en) | 2014-01-24 | 2018-10-09 | Ngm Biopharmaceuticals, Inc. | Beta-klotho binding proteins |
US10744191B2 (en) | 2014-01-24 | 2020-08-18 | Ngm Biopharmaceuticals, Inc. | Beta klotho-binding proteins and methods of use thereof |
US11596676B2 (en) | 2014-01-24 | 2023-03-07 | Ngm Biopharmaceuticals, Inc. | Methods of treating nonalcoholic steatohepatitis comprising administering an anti-human beta klotho antibody or binding fragment thereof |
US10398758B2 (en) | 2014-05-28 | 2019-09-03 | Ngm Biopharmaceuticals, Inc. | Compositions comprising variants of FGF19 polypeptides and uses thereof for the treatment of hyperglycemic conditions |
US11241481B2 (en) | 2014-06-16 | 2022-02-08 | Ngm Biopharmaceuticals, Inc. | Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
US10456449B2 (en) | 2014-06-16 | 2019-10-29 | Ngm Biopharmaceuticals, Inc. | Methods and uses for modulating bile acid homeostasis and treatment of bile acid disorders and diseases |
US10786576B2 (en) | 2014-06-23 | 2020-09-29 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
WO2015198199A1 (en) * | 2014-06-23 | 2015-12-30 | Novartis Ag | Hsa-gdf-15 fusion polypeptide and use thereof. |
US10588980B2 (en) | 2014-06-23 | 2020-03-17 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
US11752211B2 (en) | 2014-06-23 | 2023-09-12 | Novartis Ag | Fatty acids and their use in conjugation to biomolecules |
US9834586B2 (en) | 2014-07-30 | 2017-12-05 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US11358995B2 (en) | 2014-07-30 | 2022-06-14 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US10517929B2 (en) | 2014-10-23 | 2019-12-31 | Ngm Biopharmaceuticals, Inc. | Pharmaceutical compositions comprising FGF19 variants |
US9920118B2 (en) | 2014-10-31 | 2018-03-20 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US10562965B2 (en) | 2014-10-31 | 2020-02-18 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US11530260B2 (en) | 2014-10-31 | 2022-12-20 | Ngm Biopharmaceuticals, Inc. | Compositions and methods of use for treating metabolic disorders |
US11141460B2 (en) | 2014-11-07 | 2021-10-12 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders |
US10434144B2 (en) | 2014-11-07 | 2019-10-08 | Ngm Biopharmaceuticals, Inc. | Methods for treatment of bile acid-related disorders and prediction of clinical sensitivity to treatment of bile acid-related disorders |
US10800843B2 (en) | 2015-07-29 | 2020-10-13 | Ngm Biopharmaceuticals, Inc. | Beta klotho-binding proteins |
US11667708B2 (en) | 2015-07-29 | 2023-06-06 | Ngm Biopharmaceuticals, Inc. | Anti-human beta klotho antibody or binding fragment thereof and methods of their use |
US10744185B2 (en) | 2015-11-09 | 2020-08-18 | Ngm Biopharmaceuticals, Inc. | Methods of using variants of FGF19 polypeptides for the treatment of pruritus |
WO2017109706A1 (en) | 2015-12-22 | 2017-06-29 | Novartis Ag | Methods of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) |
EP3425392A4 (en) * | 2016-02-29 | 2020-02-05 | Public University Corporation Yokohama City University | Method for detecting castration-resistant prostate cancer and detection reagent |
US11604194B2 (en) | 2016-02-29 | 2023-03-14 | Public University Corporation Yokohama City University | Method for detecting castration-resistant prostate cancer and detection reagent |
CN108700573A (en) * | 2016-02-29 | 2018-10-23 | 公立大学法人横滨市立大学 | Detect the method and detection reagent of castration-resistant prostate cancer |
CN108700573B (en) * | 2016-02-29 | 2021-06-11 | 公立大学法人横滨市立大学 | Method and detection reagent for detecting castration-resistant prostate cancer |
US10174119B2 (en) | 2016-03-31 | 2019-01-08 | Ngm Biopharmaceuticals, Inc. | Binding proteins and methods of use thereof |
US10975154B2 (en) | 2016-03-31 | 2021-04-13 | Ngm Biopharmaceuticals, Inc. | Binding proteins and methods of use thereof |
US11370841B2 (en) | 2016-08-26 | 2022-06-28 | Ngm Biopharmaceuticals, Inc. | Methods of treating fibroblast growth factor 19-mediated cancers and tumors |
WO2018071493A1 (en) * | 2016-10-12 | 2018-04-19 | Janssen Biotech, Inc. | Methods for screening for modulators of gdf15-like biological activity |
WO2018102854A1 (en) * | 2016-12-06 | 2018-06-14 | St Vincent's Hospital Sydney Limited | Treatment of obesity and eating disorders |
US10398782B2 (en) | 2017-05-23 | 2019-09-03 | Novo Nordisk A/S | MIC-1 compounds and uses thereof |
WO2019048660A1 (en) | 2017-09-10 | 2019-03-14 | Novo Nordisk A/S | Mic-1 and glp-1 for use in the treatment of obesity |
US11161889B2 (en) | 2018-04-09 | 2021-11-02 | Amgen Inc. | Growth differentiation factor 15 fusion proteins |
WO2020031149A2 (en) | 2018-08-10 | 2020-02-13 | Novartis Ag | Gfral extracellular domains and methods of use |
US11512065B2 (en) | 2019-10-07 | 2022-11-29 | Kallyope, Inc. | GPR119 agonists |
US11851429B2 (en) | 2020-05-19 | 2023-12-26 | Kallyope, Inc. | AMPK activators |
US11279702B2 (en) | 2020-05-19 | 2022-03-22 | Kallyope, Inc. | AMPK activators |
US11407768B2 (en) | 2020-06-26 | 2022-08-09 | Kallyope, Inc. | AMPK activators |
WO2022219495A1 (en) | 2021-04-12 | 2022-10-20 | Novartis Ag | 2-((4-((s)-2-(4-chloro-2-fluorophenyl)-2-methylbenzo[d][1,3]dioxol-4-yl)piperidin-1-yl)methyl)-1-(((s)-oxetan-2-yl)methyl)-1h-imidazole derivatives as activators of the glp1 receptor for the treatment of obesity |
WO2023152698A1 (en) | 2022-02-10 | 2023-08-17 | Novartis Ag | 2-((4-((s)-2-(4-chloro-2-fluorophenyl)-2-methylbenzo[d][1,3]dioxol-4-yl)piperidin-1-yl)methyl)-1-(((s)-oxetan-2-yl)methyl)-1h-imidazole derivatives as activators of the glp1 receptor for the treatment of obesity |
WO2023154953A1 (en) | 2022-02-14 | 2023-08-17 | Ngm Biopharmaceuticals, Inc. | Gdf15 polypeptides for treating and preventing autoimmune diseases |
Also Published As
Publication number | Publication date |
---|---|
EP2694092B1 (en) | 2017-01-04 |
CN103533951B (en) | 2017-04-19 |
AU2012240102B2 (en) | 2016-04-14 |
AU2012240102A1 (en) | 2013-10-17 |
JP5977814B2 (en) | 2016-08-24 |
MX343729B (en) | 2016-11-18 |
CA2832581C (en) | 2022-08-23 |
US20200325200A1 (en) | 2020-10-15 |
JP2014511863A (en) | 2014-05-19 |
AU2012240102C1 (en) | 2016-09-08 |
WO2012138919A9 (en) | 2013-03-07 |
US10752664B2 (en) | 2020-08-25 |
MX2013011726A (en) | 2014-03-27 |
US20150307575A1 (en) | 2015-10-29 |
CN103533951A (en) | 2014-01-22 |
WO2012138919A3 (en) | 2013-01-17 |
CA2832581A1 (en) | 2012-10-11 |
EP2694092A2 (en) | 2014-02-12 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20200325200A1 (en) | Method of treating or ameliorating metabolic disorders using growth differentiation factor 15 (gdf-15) | |
US11739131B2 (en) | Growth differentiation factor 15 (GDF-15) polypeptides | |
US20180000898A1 (en) | Method of Treating or Ameliorating Type 1 Diabetes Using FGF21 | |
US9474792B2 (en) | Method of treating metabolic disorders using PLA2G12A polypeptides and PLA2G12A mutant polypeptides | |
AU2016203988B2 (en) | Protein to promote blood vessel growth and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12761825 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 2014504005 Country of ref document: JP Kind code of ref document: A Ref document number: 2832581 Country of ref document: CA |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2013/011726 Country of ref document: MX |
|
ENP | Entry into the national phase |
Ref document number: 2012240102 Country of ref document: AU Date of ref document: 20120405 Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 14009790 Country of ref document: US |
|
REEP | Request for entry into the european phase |
Ref document number: 2012761825 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2012761825 Country of ref document: EP |