WO1998002555A1 - Applications for regulatory region of nos isoforms - Google Patents
Applications for regulatory region of nos isoforms Download PDFInfo
- Publication number
- WO1998002555A1 WO1998002555A1 PCT/US1997/012568 US9712568W WO9802555A1 WO 1998002555 A1 WO1998002555 A1 WO 1998002555A1 US 9712568 W US9712568 W US 9712568W WO 9802555 A1 WO9802555 A1 WO 9802555A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- nitric oxide
- oxide synthase
- seq
- agent
- peptide
- Prior art date
Links
- 230000001105 regulatory effect Effects 0.000 title abstract description 72
- 102000001708 Protein Isoforms Human genes 0.000 title description 55
- 108010029485 Protein Isoforms Proteins 0.000 title description 55
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 311
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical compound O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 claims abstract description 251
- 108010021487 Nitric Oxide Synthase Proteins 0.000 claims abstract description 205
- 102000008299 Nitric Oxide Synthase Human genes 0.000 claims abstract description 204
- 239000003795 chemical substances by application Substances 0.000 claims abstract description 179
- 230000000694 effects Effects 0.000 claims abstract description 147
- 108010076864 Nitric Oxide Synthase Type II Proteins 0.000 claims abstract description 146
- 102000011779 Nitric Oxide Synthase Type II Human genes 0.000 claims abstract description 143
- 238000000034 method Methods 0.000 claims abstract description 59
- 238000004519 manufacturing process Methods 0.000 claims abstract description 31
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 23
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 21
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 21
- 201000010099 disease Diseases 0.000 claims abstract description 20
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 20
- 230000027455 binding Effects 0.000 claims description 246
- 108010041952 Calmodulin Proteins 0.000 claims description 218
- 102000000584 Calmodulin Human genes 0.000 claims description 217
- 108010075520 Nitric Oxide Synthase Type III Proteins 0.000 claims description 135
- 102000006538 Nitric Oxide Synthase Type I Human genes 0.000 claims description 124
- 108010008858 Nitric Oxide Synthase Type I Proteins 0.000 claims description 124
- 150000001413 amino acids Chemical class 0.000 claims description 53
- 230000002401 inhibitory effect Effects 0.000 claims description 47
- 239000012634 fragment Substances 0.000 claims description 31
- 229930027945 nicotinamide-adenine dinucleotide Natural products 0.000 claims description 30
- 230000004913 activation Effects 0.000 claims description 27
- 230000027756 respiratory electron transport chain Effects 0.000 claims description 27
- 241000124008 Mammalia Species 0.000 claims description 20
- 239000004475 Arginine Substances 0.000 claims description 18
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 claims description 18
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 18
- 239000012190 activator Substances 0.000 claims description 16
- 230000000903 blocking effect Effects 0.000 claims description 8
- 238000006467 substitution reaction Methods 0.000 claims description 8
- 230000000295 complement effect Effects 0.000 claims description 7
- 230000003213 activating effect Effects 0.000 claims description 6
- 229940123921 Nitric oxide synthase inhibitor Drugs 0.000 claims description 4
- 239000000236 nitric oxide synthase inhibitor Substances 0.000 claims description 4
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 claims description 3
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 claims description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 3
- 239000004472 Lysine Substances 0.000 claims description 3
- 108010085091 Ser-Ser-Trp-Arg-Arg-Lys-Arg-Lys-Glu-Ser-Ser Proteins 0.000 claims description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 3
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 claims description 2
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 claims description 2
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 claims description 2
- 229960003104 ornithine Drugs 0.000 claims description 2
- 102000008052 Nitric Oxide Synthase Type III Human genes 0.000 claims 19
- ACFIXJIJDZMPPO-NNYOXOHSSA-N NADPH Chemical compound C1=CCC(C(=O)N)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]2[C@H]([C@@H](OP(O)(O)=O)[C@@H](O2)N2C3=NC=NC(N)=C3N=C2)O)O1 ACFIXJIJDZMPPO-NNYOXOHSSA-N 0.000 claims 2
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 169
- 238000003556 assay Methods 0.000 abstract description 18
- 239000000816 peptidomimetic Substances 0.000 abstract description 15
- -1 antibodies Proteins 0.000 abstract description 3
- 102100028452 Nitric oxide synthase, endothelial Human genes 0.000 description 117
- FVTCRASFADXXNN-SCRDCRAPSA-N flavin mononucleotide Chemical compound OP(=O)(O)OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O FVTCRASFADXXNN-SCRDCRAPSA-N 0.000 description 79
- 229940013640 flavin mononucleotide Drugs 0.000 description 78
- 239000011768 flavin mononucleotide Substances 0.000 description 78
- FVTCRASFADXXNN-UHFFFAOYSA-N flavin mononucleotide Natural products OP(=O)(O)OCC(O)C(O)C(O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O FVTCRASFADXXNN-UHFFFAOYSA-N 0.000 description 78
- 235000019231 riboflavin-5'-phosphate Nutrition 0.000 description 78
- 102000004190 Enzymes Human genes 0.000 description 69
- 108090000790 Enzymes Proteins 0.000 description 69
- 229920001184 polypeptide Polymers 0.000 description 66
- 238000003780 insertion Methods 0.000 description 53
- 230000037431 insertion Effects 0.000 description 53
- 101710111444 Nitric oxide synthase, brain Proteins 0.000 description 48
- 102100022397 Nitric oxide synthase, brain Human genes 0.000 description 47
- 101710090055 Nitric oxide synthase, endothelial Proteins 0.000 description 47
- 239000003112 inhibitor Substances 0.000 description 41
- 102000004316 Oxidoreductases Human genes 0.000 description 29
- 108090000854 Oxidoreductases Proteins 0.000 description 29
- 235000001014 amino acid Nutrition 0.000 description 29
- XJLXINKUBYWONI-DQQFMEOOSA-N [[(2r,3r,4r,5r)-5-(6-aminopurin-9-yl)-3-hydroxy-4-phosphonooxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2s,3r,4s,5s)-5-(3-carbamoylpyridin-1-ium-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphate Chemical compound NC(=O)C1=CC=C[N+]([C@@H]2[C@H]([C@@H](O)[C@H](COP([O-])(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](OP(O)(O)=O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 XJLXINKUBYWONI-DQQFMEOOSA-N 0.000 description 28
- 229940024606 amino acid Drugs 0.000 description 28
- 239000000523 sample Substances 0.000 description 28
- 150000003278 haem Chemical class 0.000 description 25
- 238000012360 testing method Methods 0.000 description 24
- 102000004020 Oxygenases Human genes 0.000 description 23
- 108090000417 Oxygenases Proteins 0.000 description 23
- 230000005764 inhibitory process Effects 0.000 description 22
- 235000019162 flavin adenine dinucleotide Nutrition 0.000 description 21
- 239000011714 flavin adenine dinucleotide Substances 0.000 description 21
- 229940093632 flavin-adenine dinucleotide Drugs 0.000 description 21
- 230000003993 interaction Effects 0.000 description 21
- 239000003446 ligand Substances 0.000 description 21
- 239000011575 calcium Substances 0.000 description 20
- VWWQXMAJTJZDQX-UYBVJOGSSA-N flavin adenine dinucleotide Chemical compound C1=NC2=C(N)N=CN=C2N1[C@@H]([C@H](O)[C@@H]1O)O[C@@H]1CO[P@](O)(=O)O[P@@](O)(=O)OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C2=NC(=O)NC(=O)C2=NC2=C1C=C(C)C(C)=C2 VWWQXMAJTJZDQX-UYBVJOGSSA-N 0.000 description 20
- 238000003776 cleavage reaction Methods 0.000 description 19
- 108090000623 proteins and genes Proteins 0.000 description 19
- 230000007017 scission Effects 0.000 description 19
- HNXQXTQTPAJEJL-UHFFFAOYSA-N 2-aminopteridin-4-ol Chemical compound C1=CN=C2NC(N)=NC(=O)C2=N1 HNXQXTQTPAJEJL-UHFFFAOYSA-N 0.000 description 16
- 102000004169 proteins and genes Human genes 0.000 description 15
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 14
- 239000002253 acid Substances 0.000 description 14
- 210000004899 c-terminal region Anatomy 0.000 description 14
- 229910052791 calcium Inorganic materials 0.000 description 14
- 235000018102 proteins Nutrition 0.000 description 14
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical group OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 13
- 238000012216 screening Methods 0.000 description 13
- 108010057366 Flavodoxin Proteins 0.000 description 12
- 230000006870 function Effects 0.000 description 12
- 125000003275 alpha amino acid group Chemical group 0.000 description 11
- 230000001908 autoinhibitory effect Effects 0.000 description 11
- 238000013461 design Methods 0.000 description 11
- 101150053185 P450 gene Proteins 0.000 description 9
- 230000007246 mechanism Effects 0.000 description 9
- 239000000178 monomer Substances 0.000 description 9
- 230000003389 potentiating effect Effects 0.000 description 9
- 108010045510 NADPH-Ferrihemoprotein Reductase Proteins 0.000 description 8
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 8
- 210000004027 cell Anatomy 0.000 description 8
- 239000013068 control sample Substances 0.000 description 8
- 230000001404 mediated effect Effects 0.000 description 8
- 239000001301 oxygen Substances 0.000 description 8
- 229910052760 oxygen Inorganic materials 0.000 description 8
- FNKQXYHWGSIFBK-RPDRRWSUSA-N sapropterin Chemical compound N1=C(N)NC(=O)C2=C1NC[C@H]([C@@H](O)[C@@H](O)C)N2 FNKQXYHWGSIFBK-RPDRRWSUSA-N 0.000 description 8
- 229960004617 sapropterin Drugs 0.000 description 8
- 102100023897 NADPH-cytochrome P450 reductase Human genes 0.000 description 7
- 206010040070 Septic Shock Diseases 0.000 description 7
- 150000007513 acids Chemical class 0.000 description 7
- 230000001419 dependent effect Effects 0.000 description 7
- 238000006073 displacement reaction Methods 0.000 description 7
- 125000000524 functional group Chemical group 0.000 description 7
- 238000009396 hybridization Methods 0.000 description 7
- 230000001939 inductive effect Effects 0.000 description 7
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 6
- 125000003118 aryl group Chemical group 0.000 description 6
- 238000006471 dimerization reaction Methods 0.000 description 6
- 239000002853 nucleic acid probe Substances 0.000 description 6
- 241000283690 Bos taurus Species 0.000 description 5
- 108010057573 Flavoproteins Proteins 0.000 description 5
- 102000003983 Flavoproteins Human genes 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 230000002378 acidificating effect Effects 0.000 description 5
- 230000007423 decrease Effects 0.000 description 5
- 206010012601 diabetes mellitus Diseases 0.000 description 5
- 229910052739 hydrogen Inorganic materials 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 238000001228 spectrum Methods 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 4
- CWYNVVGOOAEACU-UHFFFAOYSA-N Fe2+ Chemical compound [Fe+2] CWYNVVGOOAEACU-UHFFFAOYSA-N 0.000 description 4
- 102000008015 Hemeproteins Human genes 0.000 description 4
- 108010089792 Hemeproteins Proteins 0.000 description 4
- 238000003491 array Methods 0.000 description 4
- 230000003197 catalytic effect Effects 0.000 description 4
- 238000007796 conventional method Methods 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 230000014509 gene expression Effects 0.000 description 4
- 150000004676 glycans Chemical class 0.000 description 4
- 239000001257 hydrogen Substances 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 229920001282 polysaccharide Polymers 0.000 description 4
- 239000005017 polysaccharide Substances 0.000 description 4
- 239000011541 reaction mixture Substances 0.000 description 4
- 230000036303 septic shock Effects 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 150000007944 thiolates Chemical class 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 238000011282 treatment Methods 0.000 description 4
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 3
- 208000030507 AIDS Diseases 0.000 description 3
- 102000002004 Cytochrome P-450 Enzyme System Human genes 0.000 description 3
- 108010015742 Cytochrome P-450 Enzyme System Proteins 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 206010020772 Hypertension Diseases 0.000 description 3
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical compound NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 description 3
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 3
- 102100029438 Nitric oxide synthase, inducible Human genes 0.000 description 3
- 108010033276 Peptide Fragments Proteins 0.000 description 3
- 102000007079 Peptide Fragments Human genes 0.000 description 3
- 101100026634 Rattus norvegicus Nos1 gene Proteins 0.000 description 3
- 206010044248 Toxic shock syndrome Diseases 0.000 description 3
- 231100000650 Toxic shock syndrome Toxicity 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- 230000003281 allosteric effect Effects 0.000 description 3
- 150000001483 arginine derivatives Chemical class 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- 238000006555 catalytic reaction Methods 0.000 description 3
- 229960002173 citrulline Drugs 0.000 description 3
- 235000013477 citrulline Nutrition 0.000 description 3
- 230000002860 competitive effect Effects 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- GRWZHXKQBITJKP-UHFFFAOYSA-L dithionite(2-) Chemical compound [O-]S(=O)S([O-])=O GRWZHXKQBITJKP-UHFFFAOYSA-L 0.000 description 3
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 3
- BTIJJDXEELBZFS-UHFFFAOYSA-K hemin Chemical compound [Cl-].[Fe+3].[N-]1C(C=C2C(=C(C)C(C=C3C(=C(C)C(=C4)[N-]3)C=C)=N2)C=C)=C(C)C(CCC(O)=O)=C1C=C1C(CCC(O)=O)=C(C)C4=N1 BTIJJDXEELBZFS-UHFFFAOYSA-K 0.000 description 3
- 210000004408 hybridoma Anatomy 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000004968 inflammatory condition Effects 0.000 description 3
- 230000002452 interceptive effect Effects 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 230000001052 transient effect Effects 0.000 description 3
- 229930024421 Adenine Natural products 0.000 description 2
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- 206010012289 Dementia Diseases 0.000 description 2
- 241000605716 Desulfovibrio Species 0.000 description 2
- 101900048434 Desulfovibrio vulgaris Flavodoxin Proteins 0.000 description 2
- 102100024099 Disks large homolog 1 Human genes 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 101001053984 Homo sapiens Disks large homolog 1 Proteins 0.000 description 2
- 101000951365 Homo sapiens Disks large-associated protein 5 Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 108010067902 Peptide Library Proteins 0.000 description 2
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 229960000643 adenine Drugs 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- 230000003042 antagnostic effect Effects 0.000 description 2
- 210000000628 antibody-producing cell Anatomy 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 238000009835 boiling Methods 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 239000000306 component Substances 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000012790 confirmation Methods 0.000 description 2
- 230000009260 cross reactivity Effects 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 230000006866 deterioration Effects 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 150000001261 hydroxy acids Chemical class 0.000 description 2
- 238000005805 hydroxylation reaction Methods 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 210000004153 islets of langerhan Anatomy 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 229910017604 nitric acid Inorganic materials 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 229920000728 polyester Polymers 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000017854 proteolysis Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000008521 reorganization Effects 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000036964 tight binding Effects 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 238000006276 transfer reaction Methods 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 230000007704 transition Effects 0.000 description 2
- 230000006442 vascular tone Effects 0.000 description 2
- 206010065040 AIDS dementia complex Diseases 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- LSNNMFCWUKXFEE-UHFFFAOYSA-M Bisulfite Chemical compound OS([O-])=O LSNNMFCWUKXFEE-UHFFFAOYSA-M 0.000 description 1
- 101100189913 Caenorhabditis elegans pept-1 gene Proteins 0.000 description 1
- 208000037823 Cerebral ischemia/reperfusion injury Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 206010013142 Disinhibition Diseases 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 206010058314 Dysplasia Diseases 0.000 description 1
- 208000010228 Erectile Dysfunction Diseases 0.000 description 1
- 102000031716 FMN binding proteins Human genes 0.000 description 1
- 108091009974 FMN binding proteins Proteins 0.000 description 1
- 101000941893 Felis catus Leucine-rich repeat and calponin homology domain-containing protein 1 Proteins 0.000 description 1
- 108010046335 Ferredoxin-NADP Reductase Proteins 0.000 description 1
- 108010074122 Ferredoxins Proteins 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 206010019196 Head injury Diseases 0.000 description 1
- 108010025076 Holoenzymes Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- MRAUNPAHJZDYCK-BYPYZUCNSA-N L-nitroarginine Chemical compound OC(=O)[C@@H](N)CCCNC(=N)N[N+]([O-])=O MRAUNPAHJZDYCK-BYPYZUCNSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 102100030856 Myoglobin Human genes 0.000 description 1
- 108010062374 Myoglobin Proteins 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- DFPAKSUCGFBDDF-UHFFFAOYSA-N Nicotinamide Chemical group NC(=O)C1=CC=CN=C1 DFPAKSUCGFBDDF-UHFFFAOYSA-N 0.000 description 1
- 101710089543 Nitric oxide synthase, inducible Proteins 0.000 description 1
- SNIOPGDIGTZGOP-UHFFFAOYSA-N Nitroglycerin Chemical compound [O-][N+](=O)OCC(O[N+]([O-])=O)CO[N+]([O-])=O SNIOPGDIGTZGOP-UHFFFAOYSA-N 0.000 description 1
- 239000000006 Nitroglycerin Substances 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 241000282320 Panthera leo Species 0.000 description 1
- 108010088535 Pep-1 peptide Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-N Propionic acid Chemical group CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 239000013614 RNA sample Substances 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical group [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 208000024716 acute asthma Diseases 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O ammonium group Chemical group [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 229940124572 antihypotensive agent Drugs 0.000 description 1
- 210000003433 aortic smooth muscle cell Anatomy 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000012503 blood component Substances 0.000 description 1
- 230000036772 blood pressure Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 230000006931 brain damage Effects 0.000 description 1
- 231100000874 brain damage Toxicity 0.000 description 1
- 230000004641 brain development Effects 0.000 description 1
- 208000029028 brain injury Diseases 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 150000005829 chemical entities Chemical class 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 208000037516 chromosome inversion disease Diseases 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000009849 deactivation Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000030609 dephosphorylation Effects 0.000 description 1
- 238000006209 dephosphorylation reaction Methods 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 238000003795 desorption Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 230000010339 dilation Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 238000002635 electroconvulsive therapy Methods 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000004907 flux Effects 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 229960003711 glyceryl trinitrate Drugs 0.000 description 1
- 150000002357 guanidines Chemical class 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 229960001438 immunostimulant agent Drugs 0.000 description 1
- 239000003022 immunostimulating agent Substances 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 201000001881 impotence Diseases 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000006917 intersubunit interaction Effects 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 230000003907 kidney function Effects 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 238000011866 long-term treatment Methods 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 238000000302 molecular modelling Methods 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 210000004897 n-terminal region Anatomy 0.000 description 1
- 230000018791 negative regulation of catalytic activity Effects 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000018052 penile erection Effects 0.000 description 1
- 230000008855 peristalsis Effects 0.000 description 1
- 125000005496 phosphonium group Chemical group 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920000548 poly(silane) polymer Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920002647 polyamide Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 150000004032 porphyrins Chemical class 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000002287 radioligand Substances 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 238000009738 saturating Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000007086 side reaction Methods 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 230000003335 steric effect Effects 0.000 description 1
- 125000000472 sulfonyl group Chemical group *S(*)(=O)=O 0.000 description 1
- 229910052717 sulfur Chemical group 0.000 description 1
- 239000011593 sulfur Chemical group 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- ISIJQEHRDSCQIU-UHFFFAOYSA-N tert-butyl 2,7-diazaspiro[4.5]decane-7-carboxylate Chemical compound C1N(C(=O)OC(C)(C)C)CCCC11CNCC1 ISIJQEHRDSCQIU-UHFFFAOYSA-N 0.000 description 1
- 230000036962 time dependent Effects 0.000 description 1
- 230000009495 transient activation Effects 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 239000005526 vasoconstrictor agent Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0071—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14)
- C12N9/0073—Oxidoreductases (1.) acting on paired donors with incorporation of molecular oxygen (1.14) with NADH or NADPH as one donor, and incorporation of one atom of oxygen 1.14.13
- C12N9/0075—Nitric-oxide synthase (1.14.13.39)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- Nitric oxide (NO) a small molecule which is highly toxic at moderate concentrations, is a key messenger m mammalian physiology. NO is produced in humans by three related enzymes which comprise the nitric oxide synthase (NOS) family.
- NOS nitric oxide synthase
- Endothelial NOS produces NO which controls vascular tone (hence blood pressure), dilates the airways, and controls numerous processes dependent on local dilation of blood vessels (such as gas exchange in lungs, penile erection, and renal function) .
- Brain or neuronal NOS produces NO which functions as a neurotransmitter. It controls peristalsis in the gut, and is implicated in neural potentiation and brain development.
- NNOS and ENOS are constitutive enzymes controlled by intracellular calcium and the regulatory protein calmodulin (CAM) . When the level of calcium in the cell rises, NNOS and ⁇ NOS bind calmodulin and are turned on to start NO production.
- CAM regulatory protein calmodulin
- a third, inducible NOS, immune NOS or macrophage NOS is synthesized by the immune system m response to an immune challenge. Upon induced expression, this enzyme is always active; it has a calmodulin binding site, but binds calmodulin tightly even at low calcium levels. INOS produces orders of magnitude more NO than other NO synthases . This NO level is cytotoxic to tumor cells, bacteria, and other pathogenic organisms.
- INOS While INOS thus appears to be an important component of immune response, its activity is highly toxic as well. Excess production of NO by INOS can be responsible for toxic shock syndrome, septic shock, and killing of islet cells in diabetes. Excess NO production by INOS has also been implicated in a wide range of other autoimmune conditions, including arthritis and other inflammatory conditions .
- the current invention concerns recently discovered intrinsic control site elements of constitutive nitric oxide synthases.
- These intrinsic control site elements referred to as “regulatory peptides, " include the regulatory peptide of endothelial nitric oxide synthase (ENOS), MSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTD (SEQ. ID. NO. 1); the regulatory peptide of neuronal nitric oxide synthase (NNOS) MRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLLRDNFE (SEQ. ID. NO.
- Agents include agents that inhibit NOS activity by blocking calmodulin activation of the NOS enzyme; agents that inhibit NOS activity by blocking electron transfer from NADPH to an active site in NOS; agents that activate a constitutive NOS enzyme by antagonizing autoinhibition of a regulatory region of the NOS enzyme; and agents that modulate NOS activity by interacting with the regulatory peptide or spatially adjacent control regions.
- the agents include the peptides described above, as well as derivatives of these peptides, and homologous peptides.
- Homologous peptides include substantially isolated peptides having an array of at least two positively charged ammo acids, and an amino acid sequence of at least about 60% homology, or about 67% homology, or about 80% homology, or about 90% homology, to the ammo acid sequence of the ENOS regulatory peptide, peptides having an ammo acid sequence of at least about 60% homology, or about 67% homology, or about 80% homology, or about 90% homology, to the ammo acid sequence of the NNOS regulatory peptide; peptides having an ammo acid sequence of at least about 60% homology, or about 67% homology, or about 80% homology, or about 90% homology, to the ammo acid sequence of the INOS-specifie peptide; and peptides having an ammo acid sequence of at least about 60% homology, or about 67% homology,
- the agents can be used to modulate the activity of NOS enzymes. Preferably, the agents modulate the activity of one NOS enzyme, but do not substantially affect the activity of the other NOS enzymes.
- Such agents can be used to treat diseases or conditions mediated by production of nitric oxide by mducible nitric oxide synthase, such as toxic shock, septic shock, autoimmune diseases, inflammatory conditions, and diabetes.
- the agents can also be used to treat diseases or conditions mediated by production of nitric oxide by a constitutive NOS enzyme, such as hypertension, diabetes, or AIDS-related dementia.
- Figure 1 demonstrates the alignment of a selected set of NOS, cytochro e P450 reductase (CPR) , and bacterial flavodoxin sequences, illustrating the conservation of regions involved in FMN binding.
- CPR cytochro e P450 reductase
- Figures 2A-2B provides evidence of transient activation of ENOS and NNOS by antibodies to the autoinhibitory sequences.
- Figure 2A shows that addition of antibody to a reaction mixture containing ENOS and arginine but not CAM produces a ⁇ 1 minute burst of NADPH consumption, followed by a phase of less marked activation.
- Figure 2B shows that addition of fresh enzyme (NNOS is shown) to a reaction mixture which has already passed through its rapid phase leads to a second burst of NADPH consumption. Addition of fresh antibody (not shown) had little or no effect, indicating that the end of the rapid phase was due to loss of native enzyme.
- NNOS fresh enzyme
- Figures 2C-2D confirms the activation of electron transfer by the antibody, and indicates the probable reason for the transient nature of activation.
- Addition of antibody to a reaction mixture containing CO and NADPH produced the spectrum shown at top, with a -420 nm Soret band visible on the side of the UV absorbance of NADPH Ferroheme-CO binding indicates that intramolecular electron transfer (the CAM controlled step in physiological conditions) has occurred.
- Dithionite addition to a similar reaction mixture produced the spectrum with the Soret band just below 450 nm. The difference spectra in the lower panel show these bands clearly.
- the Soret band formed by dithionite addition the presence of CO is characteristic of the ferrous CO adduct of a heme with a thiolate axial ligand; an identical complex can be formed by addition of CAM m the present of NADPH (not shown) .
- the 420 nm band is also due to the formation of a ferrous CO complex, confirming the activation of electron transfer, but indicates that the axial thiolate ligand of the native heme site has been lost. This is closely analogous to the conversion of P450 enzymes to the inactive P420 form
- the current invention pertains to the discovery of the existence and identity of regulatory peptides of constitutive nitric oxide synthase (NOS) enzymes.
- NOS constitutive nitric oxide synthase
- Applicant has identified the regulatory peptide of constitutive NOS enzymes as an intrinsic polypeptide insert in the flavin mononucleotide (FMN) binding domain of endothelial nitric oxide synthase (ENOS) , MSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTD (SEQ. ID. NO. 1) and in brain or neuronal nitric oxide synthase (NNOS) MRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLLRDNFE (SEQ.
- INOS Inducible nitric oxide synthase
- INOS-specific polypeptide the "INOS-specific polypeptide”
- ammo acids 600-615 of INOS SEQ. ID. NO. 3
- RRKRK the regulatory peptide
- Applicant has also identified a core region of the ENOS binding domain: the array of positively charged amino acids, RRKRK (SEQ ID NO. 10) , withm the ENOS binding domain, alters activity of the enzyme .
- Agents of the invention include agents that modulate, and particularly inhibit, nitric oxide synthase activity by, for example, blocking activation of the NOS by calmodulin.
- the agents also include agents that modulate, and particularly activate, a constitutive NOS by, for example, antagonizing or interfering with autoinhibition of the enzyme by a regulatory region of the enzyme, as described herein.
- the agents also include agents which bind to sites spatially adjacent to the calmodulin binding site of a constitutive NOS enzyme.
- the agents further include agents that inhibit NOS by blocking electron transfer from NADPH to an active site in NOS.
- Representative agents include certain substantially isolated peptides, including the regulatory peptides of ENOS and NNOS, the INOS-specific peptide, the negatively charged loops of INOS, ENOS and NNOS, as well as derivatives of the peptides and homologous peptides. Nucleic acids encoding the peptides, derivatives and homologous peptides are also available, as are antibodies specific to the peptides, their derivatives and homologs . Agents which bind to these peptides, as well as agents that bind to the control regions of the NOS isoforms, and agents which bind to functional groups within the INOS-specific peptide, are also agents of the invention.
- methods of altering the activity of ENOS, NNOS, or INOS methods of treating diseases mediated by production of nitric oxide; methods of treating conditions mediated by ENOS; and methods of treating conditions mediated by NNOS, are available.
- the methods include use or administration of the agents described herein.
- screening methods for agents that modulate NOS enzymes screening methods for agents that inhibit INOS; screening methods for agents that activate constitutive NOS enzymes; preparation and design of agents that bind to control sites for NOS isoforms; peptides, probes, nucleic acids, and antibodies of the invention; and uses of agents, peptides, and antibodies of the invention, including methods of treatment of certain diseases or conditions associated with NO production in mammals, including humans.
- Nitric Oxide Synthases Structure, Function and Control
- the oxygenase domains of ENOS and INOS extend from the N terminal to the CAM binding site.
- NNOS an additional N terminal sequence of about 200 amino acid residues is homologous to sequences in the N terminal region of DLG1 (in Drosophila elanogas ter) and PSD9, a rat neuronal protein involved in control of cell proliferation. Both proteins appear to be involved in signal recognition (Cho, K.-O. et al . , Neuron 9:929-924 (1992)). Bren an and coworkers (Brenman, J.E. et al . , Cell 52:743-752 (1995)) recently reported that this region functions as a protein recognition site. While both DLG1 and PSD9 are tyrosine kinases, the kinase active site does appear to be present in NOS.
- Cys 415 was identified as the axial heme ligand of bovine NNOS by site directed mutagenesis (McMillan, K. and Masters, B.S., Biochemis try 34 (11 ) : 3686-3693 (1995)), and corresponding cysteinyl residues are axial ligands in the other isoforms (Chen, P.-F. et al., J. Biol . Chem . 26 " 9:25062-25066 (1994)) as previously proposed (McMillan, K. e t al . , Proc . Na tl . Acad . Sci . USA 89 (23 ) : 11141-11145 (1992)) .
- the NOS oxygenase domains show no extensive similarity to P450. Some similarity between pterin binding proteins and NOS has been reported (Nishimura, J.S. et al., Bioche . Biophys . Res . Commun . 210 (2) : 288-294 (1995)). Constructs based on regions of apparent similarity can be expressed, but neither these constructs or constructs including the remainder of the oxygenase domain can be shown to bind tetrahydrobiopterin. The independently expressed construct reported by Nishimura et al . (residues 558-721 in NNOS) does bind N nitroarginine, however, indicating that it contains a significant part of the substrate binding site.
- An axial ligand of ENOS and INOS is located in a conserved region with the consensus sequence KXAWRNAXRCZGRIQWXXLQVFDARD (SEQ ID NO : 36), where Z is valine or isoleucine.
- KXAWRNAXRCZGRIQWXXLQVFDARD SEQ ID NO : 36
- Z valine or isoleucine.
- one such propionate ligand is provided by the second residue before the axial ligand, and a second by about -50 residues before the axial ligand. Therefore, at least one of the basic residues in the sequence given above is likely to be a propionate ligand, and it is not impossible that several such ligands are contributed by the sequence.
- the short sequence around the axial ligand can function as a heme binding cassette when inserted in a region with appropriate structural determinants.
- NOS is active only as a dimer (Abu-Soud, H.M. et al . , Biochemistry 34 : 11167-11175 (1995)). Independently expressed heme protein, but not flavoprotein, is dimeric, indicating that the intermonorner interactions are primarily between the oxygenase regions (McMillan, K., and Masters, B.S., Biochemis try 34 (11 ) : 3686-3693 (1995)). In previously suggested head to tail' models, the reductase unit of one monomer reduces the oxygenase unit of the other (Schmidt, H.H.H. et al., Proc . Na tl . Acad . Sci . USA 88 : 365 - 369
- the FMN binding modules of NOS isoforms are homologous to the corresponding region in CPNR and in turn to flavodoxins, a family of small FMN binding proteins.
- the INOS sequence closely corresponds to that of Desulfovibrio flavodoxin.
- a major insertion is present in ENOS and NNOS relative to flavodoxins and CPNR corresponding to the addition of an -45 residue subdomain. Alignments including numerous additional sequences of similar FMN binding domains suggest that only CNOS sequences have such an insertion, which is absent in INOS. this insertion represents the most important difference between the CNOS and INOS sequences, and correlates with Ca +2 /CAM control.
- All enzymes containing this module contain three regions involved in FMN binding (Porter, T.D., Trends in Biological Sciences 1_T:154-158 (1991)) extending from the CAM binding site to the C terminal. Bredt, D.S. et al., Na ture 351:714-718 (1991)) identified a region contributing several residues interacting the FMN, including a shielding aromatic. An additional region near the N terminal of the module forms a number of hydrogen bonds with the terminal phosphate group of FMN, and a third region contributes a second aromatic ring in contact with FMN as well as hydrogen bond partners .
- the INOS FMN domain model structure closely corresponds to Desulfovibrio vulgaris flavodoxin.
- the domain consists of a five stranded parallel ⁇ sheet with primary helical returns and the FMN binding site along one edge on a Ross an fold motif.
- the aromatic side chains of two residues (F587 and Y625 in INOS) are in contact with the isoalloxazine ring system.
- the structures of the corresponding domains of ENOS and NNOS are also similar; the primary difference is the insertion of a -45 residue subdomain structure in the CNOS sequences .
- NOS isoforms there are three regions which contribute to the binding of FMN; the initial region is involved in a network of hydrogen bonds with the terminal phosphate group, while the second and third regions provide aromatic side chains which interact with the isoalloxazine ring system as well as hydrogen bond partners.
- the proximity of the first FMN binding region to the CAM binding site allows the N terminal edge of the FMN binding domain to be specified with great confidence.
- FNR ferredoxin NADPH reductase
- Homology models of the FAD and NADPH binding domains of NNOS establish that the isoalloxazine ring of FAD lies against the outside of the ⁇ barrel and interacts with a conserved aromatic residue inside the barrel .
- the adenine binding site is located on a loop connecting two barrel strands.
- a stacking interaction for the isoalloxazine ring is provided by the last residue in the sheet domain, which is otherwise devoted to NADPH binding.
- the NADPH binding module is a five stranded antiparallel ⁇ sheet with helical returns.
- NADPH is a dinucleotide; an adenine binding site, including a stacking aromatic residue, is located on an at> ⁇ loop.
- the nicotinamide moiety was not bound in any solved FNR structure, but can be modelled as stacked with the FAD isoalloxazine ring system.
- the aromatic residue which provides a stacking interaction with FAD is the terminal residue in FNR, and the penultimate residue in NCPR. All three NOS isoforms extend significantly beyond the NADPH binding domain, which ends with this residue. Homology modeling of the NADPH/FAD binding region indicates that the structure formed by the C terminal extension lies close to the cofactor binding sites .
- the FMN binding domain is oriented so that the cofactor binding site occupies the edge facing the other cofactors .
- the structure formed by the NOS C terminal extension is thus well positioned to mediate interactions between domains. This is likely to include interactions with the oxygenase domains, since it is likely that, at least in the active state, the heme binding region will be in close proximity to the three reductase cofactors, particularly to the FMN which is probably its immediate reductant .
- Interactions between the FMN and FAD binding domains are mediated by a subdomain, present as an insertion in the FAD binding domain between sequences forming two strands of the ⁇ barrel. This subdomain is not present in FNR. It is large enough to form extensive regions of secondary structure .
- a subdomain is present as an insertion in the FAD binding domain in all proteins which contain both FNR and flavodoxin modules. It corresponds to an extended loop (with extensive secondary structure) between two strands of the ⁇ barrel and mediates interactions between the FAD and FMN binding domains.
- the primary site of oxygen chemistry in NOS is the heme; the arginine and tetrahydrobiopterin binding sites are also located in the N terminal half of the molecule.
- the reductase domains function in catalysis is limited to the delivery of reducing equivalents to the catalytic site. It is the delivery of electrons to the catalytic site, however, that is regulated by CAM binding.
- CAM binding has been reported to affect electron transfer within the reductase domains as well as FMN/heme electron transfer (Abu-Soud, H.M. et al . , Journal of Biologi cal Chemis try 269 : 32050 (1994) ) .
- the FMN binding domain must be oriented so that the FMN is close to the isoalloxazine ring system of FAD in the adjacent domain.
- the C terminal extension regions of all three NOS isoforms are in a position to mediate Interdomain interactions, are also remote from the CAM binding site.
- the organization of the reductase domains suggests that the CAM binding site is remote from the flavin binding sites.
- the C terminal extension regions of all three NOS isoforms are adjacent to the flavin sites and hence distant from the CAM binding site. None of these regions, or the subdomain of the FAD binding module, is likely to be directly involved in control.
- the requirements for efficient FMN/heme electron transfer place the heme binding site close to the flavin binding end of the FMN binding module.
- P450 enzymes reduced by the homologous P450 reductase electron transfer into the heme site from FMN takes place through the face of the P450 defined by the loops carrying the axial thiolate ligand.
- NOS the opposite orientation would place the extended arginine binding site between the donor and acceptor.
- the 'heme binding cassette' can be close to the FMN, with either the thiolate binding face of the heme or an edge adjacent to FMN. This end of the oxygenase region can be positioned in part by interactions with the extreme C terminal region of the reductase domains.
- the oxygenase and reductase domains can be connected by a long 'strap' of polypeptide connecting the end of the CAM binding site with the oxygenase region, or utilizing the dimeric nature of the active enzyme.
- NOS is active only as a dimer . It has been previously suggested from other evidence that the reductase domains of one monomer may reduce the oxygenase domains of the other. Furthermore, independently expressed heme protein, but not flavoprotein, is dimeric, indicating that the monomer/monomer interactions are primarily between the oxygenase regions. A considerable body of evidence has been amassed which suggests that dimerization and cofactor binding are coupled, although the minimum cofactor requirement for dimerization is isoform dependent.
- Each reductase unit possibly donates electrons to the oxygenase unit of the other monomer. It is the heme site of the other monomer which is m proximity to the FMN in the active state. Each reductase unit is joined through the CAM binding region to the oxygenase unit of the same monomer, but interacts across a wide molecular surface with the oxygenase unit of the other monomer. This molecular surface is formed by the junction of the FMN and FAD binding domains, and can include structures formed from the C terminal extension.
- Antibodies raised to these polypeptide inserts bind strongly to both ENOS and NNOS; homology between the two CNOS isoforms leads to cross reactivity.
- the effect of antibody binding on the ferriheme optical spectra have been studied.
- the Soret difference spectrum has a peak at 413 nm, indicative of a shift towards the low spin state. Little electron transfer occurs in the absence of either CAM or antibody, but addition of CAM and Ca +2 leads to the formation of a 450 nm band, indicative of flavin to heme electron flow. Addition of antibody in the absence of CAM (lower trace) leads to the formation of a 420 nm species.
- CNOSs neuronal cells
- ENOS endothelial cells
- Ca 2+ /CAM calcium/calmodulin binding
- This Ca 2+ - dependent mode of regulation provides pulses of NO for moment-to-moment modulation of vascular tone and neurosignaling.
- activity of the immunostimulant- induced isoforms of NOS is Ca 2+ - independent, providing continuous high-output NO generation for host-defense.
- the major CNOS FMN module insertions are notably rich in charged residues and have an excess of positive charge. This is especially true of the ENOS isofor , which contains the motif RR RK (SEQ ID NO: 10) .
- RR RK SEQ ID NO: 10
- the pattern of conservation suggests that ENOS and NNOS insertions contain at least two motifs.
- the CAM binding site is immediately adjacent to the N- ter inal edge of the FMN binding domain. With CAM bound, the CAM recognition site can be in a helical conformation; steric constraints suggest that it extends almost directly away from the FMN binding domain. Models show the FMN binding domains of INOS and ENOS with CAM positioned above the N terminal strand of the FMN domain, relative to each other. There are 7-8 residues between the end of the CAM recognition site proper and the start of the initial strand of the ⁇ sheet; 2-3 residues at each end of this short linker are needed to clear the van der Waals surfaces of CAM and the FMN domain.
- the insert functions as a control element: (1) the correlation between Ca +2 /CAM control and the presence of the insertion, and, (2) the proximity of the CAM binding site to the insertion and the probable steric interactions which would ensue.
- the insert can act as an inhibitory polypeptide which is displaced by CAM binding. It differs from inhibitory polypeptides common to other CAM-dependent enzymes, and CAM itself, in its lack of acidic and hydrophobic amino acids; this makes direct binding of the insertion to CAM sites in NOS isoforms unlikely. Nonetheless, CAM could displace the polypeptide insert from a neighboring site by binding domain overlap or through allosteric effects.
- HNNOS-derived polypeptides weakly inhibited ENOS, but were without effect on NNOS. While all peptides were less potent on INOS, significant inhibition was obtained with ENOS 601 _ 633 (JX2, SEQ ID NO: 14) and ENOS 607 _ 634 (JX3, SEQ ID NO: 15) . Notably, inhibition of INOS activity by these peptides was rapid and complete within one minute of addition. Because CAM is very tightly bound to INOS and has a remarkably slow off-rate, w th little dissociation occurring even after boiling, inhibition probably occurs without CAM displacement.
- IC 50 values for ENOS-de ⁇ ved peptide fragments ranged from l-10 ⁇ M, and potency increased as the RRKRK (SEQ ID NO: 10) motif was progressively lengthened to include up to 33 ammo acids
- Inhibition of NNOS activity and CAM binding by insert -derived peptides was fully reversed by excess CAM (ENOS 607 . 634 , SEQ ID NO: 15), indicative of a competitive mode of inhibition.
- excess CAM ENOS 607 . 634 , SEQ ID NO: 15
- the synthetic peptides could interfere with CAM binding to NOS by interacting with either NOS or CAM itself. That NOS is the actual binding target for ENOS-derived insert peptides was demonstrated in two ways First, direct binding of peptide to [ 125 I]-CAM, quantified in the absence of NOS, was undetectable at concentrations that inhibited >90% of CAM binding to NNOS Second, ENOS- de ⁇ ved peptides markedly enhanced the dissociation rate of [ 125 I] -CAM from preformed complexes with NNOS In this experimental setting, dissociated [ 125 I] -CAM is prevented from reassociatmg with NOS by addition of a 3, 000-fold molar excess of unlabelled CAM Thus, m order for a synthetic ENOS-derived peptide to eject CAM from its binding site on NNOS, it must at least transiently form a ternary CAM-contammg complex with NOS. This supports the conclusion that the binding
- Lys S45 Exposure of Lys 545 and proximity to the CAM binding site is predicted m the above models, this site appears to be withm a helix- turn transition at the edge of the beta sheet distant from the FMN binding site (an asterisk in the right, upper panel, denotes Lys S45 ) .
- Lack of cleavage m NNOS at the site homologous to ENOS Lys 545 can be explained by the presence of a single basic residue, while ENOS contains paired basic residues (RK) . In any event, binding of CAM simplifies this cleavage pattern by providing a single dominant cut site.
- CAM binding not only protects the CAM binding site from degradation by trypsm, but exposes cleavage sites on both NNOS and ENOS which are otherwise inaccessible.
- a preponderance of evidence points to the clusters of basic residues the FMN domain insert as the trypsm cleavage sites which are exposed by CAM binding
- Exposure of cryptic sites by CAM binding could occur by an allosteric mechanism, or by displacement through binding domain overlap.
- CAM-driven movement of the insert strongly suggests a switch function for activation of NO synthesis
- CNOSs possess a polypeptide insert in their FMN binding modules that is- (1) unique to NOS isoforms which are regulated by transient CAM binding, (2) positioned adjacent to the CAM binding domain, (3) an impediment to CAM binding and hence, NOS activation, and, (4) displaced with CAM binding does occur.
- insertion in CNOSs is an autoinhibitory control element. Inhibition of NOS by the insert requires occupancy of key sites on CNOS. CAM binding displaces the insert, thus activating CNOS catalysis by "disinhibition” .
- the control mechanism requires that CAM displace the insert upon binding to CNOS; this should translate into a reduced affinity for CAM. Reciprocally, absence of the insert from INOS would preclude the otherwise expected steric hindrance to CAM binding, contributing to the much tighter binding of CAM at low levels of Ca 2+ .
- binding of the inhibitory peptide can involve at least two regions At least one recognition site binds the RRKRK (SEQ ID NO- 10) motif
- a second site can recognize sequences such as EERKSYKVRF (SEQ ID NO- 37) and EQHKSYKIRF (SEQ ID NO 38) that occur the N-termmal half of the ENOS and NNOS insertions; peptides that lack RRKRK (SEQ ID NO. 10) but contain these sequences weakly inhibit NOS activity and CAM binding.
- the insert peptide also contains an abundance of serine and threon e residues which provide potential sites for phosphorylation (12/45 residues the bovine ENOS insert) . Phosphorylation/dephosphorylation can also influence the affinity of insert peptides for binding cognate sites on CNOSs and hence, impact on parameters of NOS activation and/or deactivation .
- skeletal muscle possesses a NNOS splice variant in which the insert peptide is expanded by 36 residues, providing additional sites for possible cell-type specific modification.
- Regions of interaction on the surface of the enzyme by the insert could include the flanking surface loops of the FMN-doma , bound CAM, and additional more distant sites
- a site on the oxygenase domain consisting of an array of acidic groups could serve as a binding s ce for the basic regions on the inhibitory polypeptide insert which stabilizes the inhibited conformation of CNOS. Confirmation of the regions of interaction can be exploited to manufacture additional inhibitory agents.
- the C-terminal halves of the sequence of the FMN binding domains contain two sets of negatively charged residues.
- One such set beginning with the sequence GQGDEL in ENOS, is conserved in all NOS sesquences and other enzymes in which both the FMN and FAD binding domains are present .
- the sequence VDTRLEELGGERL m ENOS is representative of a second set of acidic residues which are conserved in CNOSs but not in INOS or in P450 reductase, which typically contain only one of the four acidic groups.
- Displacement of the inhibitory peptide may not be the only mechanism by which CAM binding stabilizes the activate conformation of CNOSs, inasmuch as CAM removal results mactivation of INOS. This can be further confirmed and exploited the manufacture of inhibitory agents .
- a novel control element in CNOSs can serve in the design of potent peptide inhibitors .
- the exposure of tryptic cleavage sites in this element represents the demonstration of a specific CAM- induced conformational change in NOS and can be a hallmark of the active conformer of NOS.
- the use of CAM to control electron transfer is unique to CNOS.
- a more fundamental difference between CNOS and other CAM-regulated proteins is the lack of a CAM analog within the CNOS inhibitory peptide.
- CNOS may not be unique in this regard; it may presage the identification of other CAM regulated systems in which the CAM/inhibitor interaction is mediated through binding domain overlap or allosteric effects, rather than competition for a common recognition site .
- An agent which "modulates" the activity of a nitric oxide synthase is an agent which either increases or decreases the activity of an NOS enzyme
- Agents which increase the activity of an NOS enzyme are those which activate or promote the activity of the NOS enzyme.
- Agents which decrease the activity of an NOS enzyme are those which inactivate, interfere with, minimize or prevent the activity of the enzyme.
- Agents of the invention can modulate NOS enzyme activity independently of calmodulin activation of the NOS enzyme, that is, whether or not calmodulin is associated with the NOS enzyme, it is the agent, rather than the calmodulin, that activates the NOS enzyme .
- a screen for an argmme analog NOS inhibitor includes argmme concentrations high enough to produce good activity for an extended time course m the absence of inhibition, but preferably not so high that strong inhibitors would be outcompeted by substrate for the binding s te All other conditions are ad usted to produce maximal or nearly maximal activity, the pterin binding site is saturated, and excess levels of calcium and calmodulin are included so that the argm e site occupancy fraction, and not electron transfer from NADPH, is rate limiting
- the strategy for screening for a pterin based inhibitor is similar, except that the arginine concentration is preferably saturating, and the enzyme is preferably pretreated with pterin analogs to be screened because of the slow "off rate" of tetrahydrobiopterin This can be accomplished with pterin
- screens for inhibitory agents that interact with the newly- identified regulatory regions of the NOS isoforms differ in that conditions are preferably chosen so that the rate limitation is imposed on the controlled steps, which are electron transfer reactions in which reduction of the catalytic heme group by NADPH is mediated by FMN and FAD. Conditions are selected so that the enzyme is replete with all cofactors and arginine, oxygen and NADPH are far above their Kd values for a sufficient time course to observe good kinetics.
- NADPH consumption can be measured, as it is easier to measure than NO or citrulline production. If NADPH consumption is inhibited, NO and citrulline production must also be inhibited; however, the converse is not true, since under some conditions NADPH or oxygen electron transfer can be uncoupled from electron transfer.
- test agent a sample of the agent to be tested
- sample of NOS thereby generating a test sample, herein referred to as a "synthase sample”
- level of NOS activity is measured.
- the level of NOS enzyme activity can be, for example, compared to the amount of activity of a control sample of the NOS under the same conditions but in the absence of the test agent .
- the level of INOS activity, or of the constitutive NOS enzyme activity is measured by any one of several methods; the choice of method depends on the intent of the assay, as described above. If the level of activity in the synthase test sample is different from the level of activity of a control sample of the NOS under the same conditions but in the absence of the test agent, then the agent modulates the activity of the NOS.
- assays can be used to determine whether an agent modulates the activity of one NOS isoform without modulating the activity of other NOS isoforms.
- an agent can be assayed to test whether it modulates the activity of INOS, without modulating the activity of a constitutive NOS enzyme.
- a sample of the agent to be tested (the "test agent"), such as an antibody, peptide, or peptidomimetic described above, is contacted with a sample of INOS (thereby generating a test sample, herein referred to as am "inducible synthase sample”); after incubation of the inducible synthase sample under conditions appropriate for activity of the enzyme, the level of INOS activity is measured.
- the level of INOS enzyme activity can be, for example, compared to the amount of activity of a control sample, of INOS under the same conditions but in the absence of the test agent.
- a sample of the constitutive NOS enzyme is contacted with the test agent, to form a second test sample (herein referred to as the "constitutive synthase sample"); after incubation of the constitutive synthase sample under conditions appropriate for activity of the enzyme, the level of activity in the constitutive synthase sample is measured, and compared with the level of activity in a sample of the same constitutive NOS enzyme, under the same conditions, without the test agent.
- the level of INOS activity, or of the constitutive NOS enzyme activity is measured by any one of several methods; the choice of method depends on the intent of the assay, as described above .
- the agent modulates the activity of INOS, but does not modulate the activity of the constitutive NOS.
- the agent modulates the activity of the constitutive NOS enzyme, and does not modulate the activity of INOS.
- inhibitors with isoform specific properties involves comparison of inhibitory effects among assays involving all three isoforms. Such assays are performed as described above, using a test and a control sample for each NOS enzyme. In selecting for NNOS or ENOS specific inhibitors, screens devised as described above are set up for NNOS and ENOS with the aim of selecting compounds which are significantly more potent inhibitors of one isoform than the other.
- An agent that "specifically inhibits" a particular NOS enzyme is an agent that inhibits that NOS isoform activity by approximately tenfold.
- INOS lacks an analog of the autoinhibitory element of ENOS and NNOS, and is a much stronger binder of CAM; INOS binding of CAM is almost irreversible. Thus, during assays to identify agents that modulate INOS activity, excess CAM is not added: because in order to express active INOS, CAM must be coexpressed, and INOS is isolated replete with its CAM complement. INOS retains a site of interaction for inhibitory peptides, but because of the effectively zero off rate for CAM these peptides must bind to the INOS-CAM complex.
- NOS specific inhibitors can also be identified by using neighboring structural elements of the control site to design and screen for agents that interact with the control site.
- These elements in INOS include the short connecting loop that is specific to inducible nitric acid synthase (SEQ ID NO. 3) , which occupies the position of the extended constitutive NOS insertion in the FMN domain, and the two flanking, negatively charged, loop sequences which correspond to the helix-strand transitions in INOS.
- SEQ ID NO. 3 An agent that binds to the loop that is specific to inducible NOS (SEQ ID NO 3) occupies a position in INOS that is analogous to that of the regulatory element in constitutive NOS, and hence has potential inhibitory character.
- Agents that bind to the flanking loops can have binding domains which overlap the binding domain for the regulatory element, and can be inhibitory.
- NOS activation was possible by any means other than by CAM activation of the enzyme.
- Activation of constitutive NOS enzymes is particularly desirable, for treatment of diseases and conditions associated with NO production.
- Activation of ENOS and NNOS can most readily be visualized in terms of an agent that binds to the regulatory element of the isoform of interest, so as to prevent autoinhibition of NOS
- An example of such an agent is an antibody to the regulatory element, which serves to interfere with the inhibited conformation
- Other agents that bind to the regulatory element can be designed or identified by screening for activation.
- activator candidates preferably have arrays of predominantly negative charges Since extension of peptides containing positive charge arrays with additional residues corresponding to ENOS and NNOS regulatory elements which contain a few, or one negative charge, produce inhibitors of lower Kd than the positive charge array alone, flanking regions bearing one, or a few positive charges around a core of negative charges can be more potent as binding agents, and hence as activators .
- flanking loop sequences of all three NOS isoforms bear negative charges .
- constitutive NOS these sequences are part of the binding domain, and possibly part of the recognition site, of the regulatory peptide
- the corresponding sequences occupy the analogous positions spatially adjacent to the vestigial regulatory site Structurally, the constitutive NOS flanking loops form the edges of a cup which surrounds the base of the regulatory peptide
- tne negative charges on these loops may interact with some of the positive charges on the regulatory peptide, and hence the synthetic peptides derived from these loops are examples of the agents bearing negative charge arrays discussed above.
- they can be CAM independent activators .
- Screens for CAM independent control site activation of a NOS enzyme uses assays in which conditions are selected for nearly maximum activity, except that no CAM is added. This includes saturation of the enzyme with arginine, oxygen and NADPH, and, if necessary, reconstitution with tetrahydrobiopterin. Potential activators are selected for their ability to stimulate NO production. While it is possible to use NADPH consumption as an initial assay for this screen, it is preferable to use NO (or citrulline) formation as a basis for the assay, as an increase in NADPH consumption could be due to an increase in the uncoupled rate of electron transfer to oxygen.
- agents that bind to the NOS isoforms control sites can be developed.
- the agents include peptides which have been identified as potent inhibitors, and agents having the same or substantially the same characteristic properties of these inhibitors, including charge arrays such as the polybasic sequences found in the control elements and their complements .
- peptidomimetics can be devised utilizing the established importance of the polybasic array in inhibitor potency.
- a peptidomimetic can be designed by substituting the peptidic backbone of the molecule with an alternative organic or inorganic backbone, whereby the basic moieties are arranged and/or presented in the same three-dimensional configuration. Steric hindrance can be introduced to improve specificity and libraries of charge complemented (primarily negative) molecules can be screened to find agents that bind to the control site elements themselves.
- Agents which modulate NOS enzyme activity include agents having an array of positively charged residues or molecules, such as the array of positively charged amino acids m ENOS-homologous peptides This agent can modulate a NOS enzyme activity by effecting electron transport between NADPH and the active site of an NOS enzyme.
- agents have at least one functional group, and may have two or more functional groups, which bind to the INOS- specific peptide, or have at least one functional group, and may have two or more functional groups, which bind to the recognition site of the inhibitory peptide in a constitutive NOS enzyme, or a homologous region inducible NOS, and thereby modulate INOS activity
- the functional group (s) of the agent can be, for example, amme groups, which bind to a carboxyl group with the INOS- specif c peptide
- certain peptides of the invention have been shown to inhibit the activity of INOS. These peptides are useful as agents which modulate INOS activity.
- agents that bind to neighboring structural elements can also serve as either activators or inhibitors by interfering with CAM binding, with the active or inactive conformation of the intrinsic autoinihibitory element, or by sterically mimicking the inhibitory effect of the autoinhibitory element.
- the negatively charged flanking loop regions form the NOS FMN binding domains are neighboring structural elements that can serve as activators or inhibitors of NOS isoforms.
- Representative agents include antibodies for the synthetic peptide analogs of the NOS control elements and neighboring structural elements. For example, antibodies which are raised to the INOS-specific polypeptide (SEQ. ID. NO.
- 3) and/or related regions can be used as agents which modulate INOS activity without modulating the activity of a constitutive NOS enzyme, because they specifically bind to INOS, but not to a constitutive NOS enzyme.
- Antibodies raised to polypeptides comprising one or both of the two negatively charged loops on the surface of the FMN binding molecule present in all known NOS isoforms also modulate INOS activity without modulating the activity of a constitutive NOS enzyme.
- the two negatively charged loops are exposed in INOS, but are not in the constitutive NOS enzymes, because the sites appear to serve as the binding site for the regulatory peptides in ENOS and NNOS, and are therefore covered by the positively charged regulatory peptide, or by the regulatory peptide and calmodulin.
- Antibodies raised to a NOS regulatory peptide can be used as agents which modulate the activity of constitutive NOS enzymes without modulating the activity of INOS, as they specifically bind to constitutive NOS enzymes, but not to INOS.
- the agent modulates the activity of INOS, without modulating the activity of a constitutive NOS enzyme (ENOS and/or NNOS) ; alternatively, the agent modulates the activity of constitutive NOS enzymes, without modulating the activity of INOS In an even more preferred embodiment, the agent modulates the activity of one constitutive NOS enzyme (ENOS or NNOS) , and does not modulate the activity of the other constitutive NOS enzyme.
- the agents of the invention include peptides, as well as antibodies, and peptidomimetics which have the same or similar activity as the peptides, as described below
- a series of peptides has been constructed and tested for the ability to modulate the activity of (e.g., inhibit and/or activate) the various NOS isoforms.
- these substantially isolated peptides relating to the regulatory peptides of NOS proteins, as well as other related peptides can serve as agents that modulate NOS activity.
- a "substantially isolated" peptide, as described herein, refers to a peptide that has been derived or removed from the environment in which it naturally occurs. Examples include a peptide fragment derived or removed from the native protein, comprising or consisting essentially of the cited sequences.
- a substantially isolated peptide would include the cited sequence, the sequence flanked by one or more ammo acids which are the same as or different from the ammo acid sequence of the native protein.
- a peptide that inhibits a NOS enzyme is referred to herein as a "nitric oxide synthase inhibitor peptide”
- a peptide that activates a NOS enzyme is referred to herein as a "nitric oxide synthase activator peptide”
- the peptides of the invention include the ENOS regulatory peptide, MSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKR KESSNTD (SEQ ID NO.
- the NNOS regulatory peptide MRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLLRDNFE (SEQ ID NO. 2); the INOS specific peptide (SEQ ID NO. 3 ) ; the regulatory region between about amino acids 590-650 of ENOS; the regulatory region between about amino acids 820-880 of NNOS; and the negatively charged loops of INOS (amino acids 568-581 (SEQ ID NO. 4) and 633-647 (SEQ ID NO. 5)); ENOS (amino acids 557-570 (SEQ ID NO. 6) and 666-680 (SEQ ID NO. 7); and NNOS (amino acids 790-803 (SEQ ID NO.
- the peptides of the invention additionally include derivatives of the ENOS regulatory peptide, NNOS regulatory peptide, INOS specific peptide, regulatory regions of ENOS and NNOS, and negatively charged loops of INOS, ENOS and NNOS.
- a "derivative" of a peptide, as described herein, is a peptide which has one or more amino acids deleted or inserted, or has one or more conservative substitutions.
- a preferred derivative has one, two or more flanking amino acids (e.g. met or native NOS amino acids) .
- a "conservative substitution”, as used herein, is the replacement of a first amino acid with a second amino acid that is similar to the first amino acid in charge, polarity, reactivity, and/or structure.
- Conservative substitutions include amino acid substitutions within the following groupings: S, T, G, A, and P; L, M, I, and V; E, D, Q, and N; R, H, and K; and F, Y, and W. Fragments of these peptides can also serve as agents that modulate NOS activity.
- a fragment of a peptide that inhibits NOS activity is referred to herein as an "inhibitory fragment;" a fragment of a peptide that activates NOS activity is referred to herein as an “activating fragment.”
- the invention further encompasses peptides that are closely related to the ENOS control region, NNOS control region, INOS specific peptide, regulatory regions of ENOS and NNOS, and negatively charged loops of INOS, ENOS and NNOS, as shown by the degree of homology, and, in the case of some peptides based on autoinhibitory elements, by the presence of a core region containing an array of positively charged amino acids.
- These closely related peptides are referred to herein as "homologous peptides”.
- the core region of a peptide homologous to the ENOS regulatory peptide contains an array of positively charged amino acids.
- the array has at least two, and preferably at least five, positively charged amino acids. At least two of the positively charged amino acids must be contiguous.
- the positively charged amino acids can be naturally-occurring or synthetic.
- each positively charged amino acid is lysine, arginine, histidine, or ornithine.
- the core region is RRKRK (SEQ ID NO. 10); in another preferred embodiment, the core region is KKRKR (SEQ ID NO. 11) .
- the homologous peptides of the invention are at least 60% homologous, or about 67% homologous, or about 80% homologous, or about 90% homologous to either a section of the ENOS regulatory peptide (SEQ ID NO. 1) , the NNOS regulatory peptide (SEQ ID NO. 2), or the INOS specific peptide (SEQ ID NO. 3) .
- the percent of homology indicates the amount of identity (or similarity) between the amino acid sequences of two peptides. The percent similarity takes into consideration close or conservative substitutions in amino acids.
- the sequence of the homologous peptide is substantially the same as the identified sequence.
- a homologous peptide of the invention is a substantially isolated peptide having an array of positively charged amino acids, and an amino acid sequence of at least about 60% homology, or about 67% homology, or about 80% homology, or about 90% homology, or is substantially the same as, the amino acid sequence of the ENOS control region (SEQ ID NO. 1) .
- the substantially isolated peptide binds to a site spatially adjacent to the calmodulin binding site of ENOS.
- Particular peptides include WRRKRK (SEQ ID NO. 12); SSWRRKRKESS (SEQ ID NO. 13); SSPRPEQHKSYKIRFNSVSCSDPLVSSWR RKRK (SEQ ID NO.
- An additional preferred peptide includes the entire autoinhibitory peptide insert.
- a homologous peptide of the invention is a substantially isolated peptide having an amino acid sequence of at least about 60% homology, or about 67% homology, or about 80% homology, or about 90% homology to, or substantially the same as, the amino acid sequence of the NNOS control region (SEQ ID NO . 2) .
- the substantially isolated peptide binds to a site that is spatially adjacent to the calmodulin binding site of NNOS.
- Particular peptides include QEERKSYKVRF (SEQ ID NO. 16) , RPEQHKSYKIRF (SEQ ID NO. 17), SDSRKSSGDGPDLR (SEQ ID NO. 18), and QEERKSYKVRFNSVSSYSDSQKSSGDGPDL (SEQ ID NO. 19) .
- other homologous peptides include a substantially isolated peptide having an amino acid sequence of at least about 60% homology, or about 67% homology, or about 80% homology, or about 90% homology to, or substantially the same as, the amino acid sequence of the INOS specific peptide (SEQ ID NO . 3) ; and a substantially isolated peptide having an amino acid sequence of at least about 60% homology, or about 67% homology, or about 80% homology, or about 90% homology to the negatively charged loops of the NOS enzymes (SEQ ID NO. 4 and 5 (INOS); 6 and 7 (ENOS), and 8 and 9 (NNOS)).
- the peptides of the invention can be prepared using conventional synthetic methods. Alternatively, they can be prepared using conventional methods of molecular genetics
- the peptides of the invention can also be prepared as fusion peptides with other peptide or proteins, or with other macromolecules , such as polysaccharides .
- the peptides of the invention can be used to raise antibodies.
- Antibodies which are raised to the peptides can be either monoclonal or polyclonal.
- the term "antibody”, as used herein, encompasses both polyclonal (e.g. murine or rabbit) and monoclonal antibodies, as well as mixtures of more than one antibody (e.g., a cocktail of different types of monoclonal antibodies) reactive with a peptide of the invention.
- the term antibody is further intended to encompass whole antibodies and/or biologically functional fragments thereof.
- Biologically functional antibody fragments which can be used are those fragments sufficient for binding of the antibody fragment to the peptide. Once the antibodies are raised, they are assessed for the ability to bind to the peptide. Conventional methods can be used to perform this assessment .
- Monoclonal antibodies (mAb) reactive with a peptide of the invention can be produced using somatic cell hybridization techniques (Kohler and Milstein, Nature 256 : 495- 497 (1975)) or other techniques.
- somatic cell hybridization techniques Kohler and Milstein, Nature 256 : 495- 497 (1975)
- a crude or purified ⁇ OS enzyme or a peptide of the invention as described above, e.g., I ⁇ OS-specific polypeptide, E ⁇ OS regulatory peptide, ⁇ OS regulatory peptide, a homologous peptide, or a derivative peptide, as described above
- An animal is immunized with the immunogen to obtain antibody- producing spleen cells.
- the species of animal immunized will vary depending on the specificity of mAb desired.
- the antibody producing cell is fused with an immortalizing cell (e.g., a myeloma cell) to create a hybridoma capable of secreting antibodies to the peptide of the invention.
- an immortalizing cell e.g., a myeloma cell
- the unfused residual antibody-producing cells and immortalizing cells are eliminated.
- Hybridomas producing desired antibodies are selected using conventional techniques and the selected hybridomas are cloned and cultured.
- Polyclonal antibodies can be prepared by immunizing an animal in a similar fashion as described above for the production of monoclonal antibodies. The animal is maintained under conditions whereby antibodies reactive with the peptide of the invention are produced. Blood is collected from the animal upon reaching a desired titer of antibodies. The serum containing the polyclonal antibodies (antisera) is separated from the other blood components. The polyclonal antibody-containing serum can optionally be further separated into fractions of particular types of antibodies (e.g., IgG, IgM) .
- Antibodies raised to either the regulatory peptide of a constitutive NOS enzyme (ENOS or NNOS) , or to the INOS- specific polypeptide, can be used to distinguish constitutive NOS enzymes from INOS, and vice versa.
- NNOS can be distinguished from ENOS and INOS, because NNOS has a long N terminal extension that is lacking in ENOS and INOS; antibodies to the regulatory peptide or to the INOS- specific polypeptide can now be used to distinguish ENOS from INOS.
- the potential for cross reactivity between NOS isoforms exists for antibodies to all other regions on the NOS surface except the regulatory peptide and the INOS- specific polypeptide.
- Antibodies can also be used as agents which alter the activity of a NOS protein, as described further below. Peptidomimetics and Other Agents
- Peptidomimetics molecules which are not polypeptides, but which mimic aspects of their structures to bind to the same site
- polysaccharides can be prepared that have the same functional groups as the peptides of the invention, and which interact with NOS enzymes in the same manner.
- Peptidomimetics can be designed, for example, by establishing the three dimensional structure of the peptide agent in the environment in which it is bound or will bind to the enzyme.
- the peptidomimetic comprises at least two components, the binding moiety or moieties and the backbone or supporting structure.
- the binding moieties are the chemical atoms or groups which will react or complex (as in forming a hydrogen or covalent bond) with the amino acid(s) at the binding site of the enzyme.
- the binding moieties in a peptidomimetic are the same as the peptide agent.
- the binding moieties can be an atom or chemical group which react with the enzyme in the same or similar manner.
- binding moieties suitable for use in designing a peptidomimetic for a basic amino acid in a peptide are nitrogen containing groups, such as amines, ammoniums, guanidines and amides or phosphoniums .
- binding moieties suitable for use in designing a peptidomimetic for an acidic amino acid can be, for example, carboxyl, lower alkyl carboxylic acid ester, sulfonic acid, a lower alkyl sulfonic acid ester or a phosphorous acid or ester thereof.
- the supporting structure is the chemical entity that, when bound to the binding moiety or moieties, provides the three dimensional configuration of the peptidomimetic.
- the supporting structure can be organic or inorganic. Examples of organic supporting structures include polysaccharides, poly ers or oligomers of organic synthetic polymers (such as, polyvinyl alcohol or polylactide) It is preferred that the supporting structure possess substantially the same size and dimensions as the peptide backbone or supporting structure This can be determined by calculating or measuring the size of the atoms and bonds of the peptide and peptidomimetic. In one embodiment, the nitrogen of the peptide bond can be substituted with oxygen or sulfur, thereby forming a polyester backbone.
- the carbonyl can be substituted with a sulfonyl group or sulfmyl group, thereby forming a polyamide.
- Reverse amides of the peptide can be made (e.g , substituting one or more -CONH- groups for a -NHCO- group)
- the peptide backbone can be substituted with a polysilane backbone.
- a polyester corresponding to the peptide RRKRK (SEQ ID NO: 10) can be prepared by the substituting a hydroxyl group for each corresponding amme group on the R and K ammo acids, thereby preparing a hydroxyacid and sequentially este ⁇ fymg the hydroxyacids , optionally blocking the basic side chains and acids to minimize side reactions . Determining an appropriate chemical synthesis route can generally be readily identified upon determining the chemical structure using no more than routine skill.
- agents can be isolated through methods described herein and are considered to be equivalent to the described agents, in that they interact with the same site on the NOS protein, fulfill the same function (e.g , alter the activity of (inhibit or activate) a specific isoform), and therefore, can be used to treat one or more diseases m which the inhibition or activation of a specific NOS lsoform is beneficial.
- This disclosure therefore encompasses such agents as can be prepared by one skilled in the art through the use of the discoveries and methods described herein.
- nucleic acid probes which optionally may encode the peptides of the invention, as described above, can also be prepared.
- Nucleic acid probes particularly those encoding or corresponding to the regulatory peptide of the constitutive NOS enzymes, ENOS and NNOS (SEQ. ID. NO 1 and NO. 2) or to the INOS-specific polypeptide (SEQ. ID NO. 3), can be used as markers for identifying and mapping NOS enzyme isoforms in humans and other organisms, as well as for probes for specific NOS enzyme genes and mRNA, and for identification of other enzymes with undiscovered but related regulatory sites
- the nucleic acid probes can comprise RNA, cDNA, or genomic DNA.
- the nucleic acid probes substantially correspond to the native nucleic acids encoding or substantially corresponding to the regulatory peptide of the constitutive NOS enzymes, ENOS and NNOS (SEQ ID. NO. 1 and NO 2), the INOS-specific polypeptide (SEQ. ID. NO. 3), or derivative or homologous peptides .
- a DNA or RNA sample (a test sample) is obtained from the organism of interest; the test sample is contacted with a nucleic acid probe, under hybridization conditions which allow hybridization of the nucleic acid probe to homologous DNA or RNA in the test sample.
- Stringency hybridization conditions can be adjusted to eliminate hybridization to extraneous sequences (see Sambrook, J. et al . , Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, NY (1989)).
- the presence (or absence) of hybridization is then detected, using conventional methods .
- the homologous DNA or RNA if present, can be isolated for further study.
- nucleic acid molecules which encode the peptides of the invention, as described above, as well as nucleic acid molecules complementary to the nucleic acid molecules, can also be prepared, using standard techniques
- isolated nucleic acid molecules can be used to prepare peptides of the invention.
- isolated nucleic acid molecules which encode the antibodies of the invention, as described above, as well as complementary nucleic acid molecules can also be prepared and used to generate antibodies of the invention.
- the agents that modulate NOS enzyme activity can be used to modulate the activity of a nitric oxide synthase enzyme in vivo .
- the agent is used to modulate the activity of a nitric oxide synthase in a mammal, such as a human, in order to treat a disease or condition associated with NO production in the mammal .
- An agent which modulates the activity of INOS, or of a constitutive NOS enzyme (NNOS or ENOS) is administered to the mammal.
- the agent can be administered subcutaneously, intravenously, intramuscularly, intraperitoneally, topically, orally, rectally, nasally, buccally, vaginally, mtraurethrally , by inhalation spray, or via an implanted reservoir.
- the agent is a peptide
- the agent can also be administered via a gene transfer vector containing a nucleic acid encoding the peptide. Administration of the gene transfer vector leads to expression of a nucleic acid sequence, resulting m production of the peptide and modulation of the specific NOS isoform.
- a gene transfer vector containing a nucleic acid encoding the peptide can also contain tissue-specific promoters, as well as other elements (e g , enhancer elements, splicing signals, termination and polyadenylation signals, viral replicons, bacterial plasmid sequences, or other vector nucleic acid sequences) . Delivery of the vector can be targeted to particular regions or cell types (e.g., by the use of decorated liposomes, or by introducing the vector m a specific region) . For example, transformation of cells with a peptide that inhibits INOS activity would be effective protection against NO-related islet cell destruction in those at risk for early onset diabetes. In another example, transformation of endothelial cells with a peptide that activates ENOS can be used for long-term treatment of hypertension.
- tissue-specific promoters as well as other elements (e g , enhancer elements, splicing signals, termination and polyadenylation signals, viral replicons, bacterial plasmi
- agent is an antibody
- gene transfer methods can also be used to administer a nucleic acid encoding the antibody or a fragment of the antibody
- Administration of the vector leads to expression of the nucleic acid sequence, resulting in production of the antibody, and, ultimately, modulation of the specific NOS isoform.
- the agent can be administered in dosage formulations containing conventional, non-toxic, physiologically- acceptable carriers, adjuvants, and/or vehicles
- dosage formulations containing conventional, non-toxic, physiologically- acceptable carriers, adjuvants, and/or vehicles
- the form in which the agents are administered will depend at least in part on the route by which they are administered.
- the agent is administered in an effective amount, which is that amount necessary to modulate the NOS enzyme
- the agent is administered m a therapeutically effective amount.
- a therapeutically effective amount is that amount necessary to reduce or eliminate symptoms associated with the disease or condition.
- the effective amount, or the therapeutically effective amount will be determined on an individual basis, and will be based in part, on consideration of the agent, the individual's size and gender, the severity of the symptoms to be treated, the result sought, the disease, etc. Thus, the therapeutically effective amount can be determined by one of ordinary skill in the art, employing such factors and using no more than routine experimentation .
- the therapeutically effective amount can be administered in a single dose, or a series of doses separated by appropriate intervals, such as hours, days, or weeks.
- single dose can be a solitary dose, and can also be a sustained release dose, such as by a controlled-release dosage formulation or a continuous infusion.
- Other drugs can also be administered in conjunction with the agent; e.g., a vasopressor administered in conjunction with an INOS inhibitor for septic shock treatment. More than one agent which modulates the activity of a NOS enzyme can be administered at the same time .
- an agent which modulates, and particularly, which increases the activity of ENOS is administered, in order to treat a condition modulated by production of nitric oxide by endothelial nitric oxide synthase, such as hypertension, atherosclerosis, or acute asthma.
- the agent does not modulate the activity of NNOS or INOS.
- An agent which increases ENOS activity will allow NO to be produced directly adjacent to the site of action. Since such an activator would not have to dissociate to produce NO, it would be stable and would not need to be "used up" to be effective.
- NO donors such as nitroglycerin are limited by the number of NO groups they contain (usually 1-3) and must be replaced as they are used up to produce NO.
- an agent which activates either ENOS and/or NNOS in the corpus cavernosa can be used as a means for treating male erectile dysfunction.
- the agent is administered mtraurethrally to limit systemic side effects .
- an agent which specifically inhibits NNOS can be used to prevent brain damage in conditions involving cerebral ischemia/reperfusion injury, such as head trauma.
- an agent which modulates, and particularly, which decreases the activity of INOS is administered in order to treat a condition modulated by production of nitric oxide by INOS, such as septic shock, toxic shock, autoimmune disease such as rheumatoid arthritis, inflammatory conditions such as inflammatory bowel disease, multiple sclerosis, or diabetes.
- a condition modulated by production of nitric oxide by INOS such as septic shock, toxic shock, autoimmune disease such as rheumatoid arthritis, inflammatory conditions such as inflammatory bowel disease, multiple sclerosis, or diabetes.
- the agent which modulates INOS activity does not modulate the activity of NNOS or ENOS.
- INOS is important in dementia associated with Acquired Immune Deficiency Syndrome (AIDS) , and is involved in the destruction of the immune system and general physical deterioration produced by the AIDS virus (Baldeway, T., et al., AIDS 10451-452 (1996); Brenner, T., et al . , Brain Res . 641 : 51 - 56 (1994); Lipson, S.A., Devel . Neurosci . 94 : 145-151 (1996); Buck, M. et al . , EMBO J. 151753-1763 (1996); Cross, et al . , J. Cl in . Inves t .
- AIDS Acquired Immune Deficiency Syndrome
- an agent which modulates the activity of INOS can be administered to combat dementia, immune system destruction, and/or physical deterioration in individuals infected with the AIDS virus.
- an agent which activates INOS can be used to treat diseases relating to dysplasia, cancer, or infectious disease. Activation of INOS can produce cytotoxic levels of NO which would aid in the elimination of dysplastic or cancerous tissue, or aid in the control of infectious agents such as viruses, microbes, or other parasites.
- NOS nitric oxide synthase
- the corresponding regions in NOS function together to bring electrons into the enzyme for production of NO from arginine and oxygen. Binding of calmodulin by NNOS and ENOS turns on electron transfer from the flavin binding region to the active site, which contains a heme cofactor.
- the calmodulin binding site in all three types of NOS is located close to the N-terminal edge of the flavodoxin module.
- NCPR NADPH cytochrome P450 reductase
- NCPR has no insertions of more than five residues after the TETGKSEALA (SEQ ID NO. 20) region in the FMN binding domain.
- Immune (macrophage) NOS (INOS or MNOS) , which binds calmodulin but does not respond to calcium, also lacks an insertion in the corresponding region.
- the constitutive NOS isoforms (ENOS and NNOS) , which bind calmodulin and are under calcium control, have extensive (40-45 residues) insertions within the FMN binding domain. This is the critical difference between the constitutive and inducible isoforms of NOS.
- the insertions are about 100 residues downstream (towards the C terminus) from the calmodulin binding site.
- this insertion lies on an external loop at one edge of the beta sheet which forms the core of the protein.
- the insert is spatially adjacent to the calmodulin binding site.
- such ligands may produce a weakly active state in the absence of calmodulin; this weakly active state is resistant to further activation.
- the negatively charged loops on the surface of the FMN binding domain appear to serve as the binding site for the regulatory peptides in ENOS and NNOS.
- the regulatory polypeptide in INOS is the short loop which is split and greatly extended by the introduction of the regulatory peptides in ENOS and NNOS.
- the backbones of the INOS and p450 reductase modules can be almost superimposed on the backbone of Desulfovibrio flavodoxin, which appears to be the closest solved structural homolog of the FMN binding modules of the NOS isoforms.
- the structure, a Rossman fold motif is a five- stranded, parallel ⁇ sheet, with the FMN binding site along one edge.
- Two aromatic residues, W and Y in INOS, are in contact with the FMN ring system; the latter serves as a shielding residue.
- ENOS Most of the corresponding backbone structure of ENOS can be superimposed on the structures of INOS and p450 reductase modules, but the insertion projects from the edge of the sheet opposite the FMN binding site.
- the backbone of NNOS is similar to ENOS. Structurally, the insertion corresponds to the replacement of a tight 5-10 residue ot> ⁇ loop with an approximately 50 residue structure which is about 1/3 the size of the entire FMN binding module. The conformation for the insertion is currently unknown.
- the calmodulin binding site is directly adjacent to the N terminal edge of the FMN binding domain.
- the site When calmodulin is bound, the site must be in a helical conformation, and can then be expected to extend almost directly away from the FMN binding domain because of steric constraints.
- Calmodulins (m.w. approximately 20 kD) are considerably larger than the entire FMN binding module.
- the insertion is midway through the sequence of the FMN binding module, it is immediately apparent that in three dimensions it is directly adjacent to the CAM binding site.
- CAM binding is likely to be sterically hindered by the insertion, and probably demands that the insertion undergo conformational reorganization. It is therefore likely that the insertion has more than one physiologically relevant conformation.
- polypeptides corresponding to promising recognition sites such as the RRKRK (SEQ ID NO: 10) motif were synthesized in lengths ranging from six to thirty five residues, as shown in Table 1, below.
- Polypeptides corresponding to both the ENOS and NNOS insertions were selected for evaluation.
- polypeptides corresponding to the neighboring > ⁇ loops in all three isoforms were synthesized, because of the possibility that these loops form a significant part of the binding site for the insertion in NOS. This possibility was suggested both by their proximity to the insertion and by their negative charge .
- JX2 b ENOS SSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRK 14
- JX3 b ENOS QHKSYKIRFNSVSCSDPLVSSWRRKRKE 15
- JX series polypeptides are approximately 30-mers derived from ENOS and NNOS inhibitory polypeptides.
- B058 series are shorter (6-mers to 15-mers) peptides derived from flanking loops or from shorter segments of inhibitory polypeptides.
- CAM binding data represents counts from radiolabeled CAM trapped on a membrane by NNOS adhesion.
- INOS activity was assayed by measuring oxidation of ferrous myoglobin by product NO. Mg/ml concentrations of larger JX series polypeptides were three times higher than others to keep molar concentrations comparable in experiments. The results of experiments to determine the effects of the synthetic polypeptides on NOS activity are shown in Table 2, below.
- the most effective inhibitory polypeptides contain the motif RRKRK (SEQ ID NO: 10) from the ENOS insertion. Partial inhibition of INOS could also be obtained with NNOS-based polypeptides.
- NOS activity measurements were performed using recombinant rat NNOS (purified from overexpressing HEK293 cells) , recombinant bovine ENOS (purified from overexpressing E. coli) or native INOS (from immunostimulant-activated rat aortic smooth muscle cells) .
- Activity was determined with 1-20 pmole of NOS using a kinetic 96-well microtiter plate assay based on the kinetics of NADPH consumption (NNOS and ENOS) or Fe 2+ -myoglobin oxidation.
- Radioligand binding was performed after incubation of 1-2 pmole of NOS for 15 minutes at 23°C with either Bolton-Hunter labelled [1251]- calmodulin (1 nM) or [3H] -N ⁇ -nitro-L-arginine (200 pM) and the indicated peptides . Results are shown in Table 3. Values are means + . SEM of triplicate determinations. TABLE 3 Effect of Peptides on NOS Activity and Ligand Binding
- the major insertion in the FMN binding module is the inhibitory polypeptide of constitutive NOS, and that its absence in INOS accounts for the lack of sensitivity of INOS to calcium, and, in part, for its very tight binding of CAM. It appears that INOS has developed from an ancestral constitutive NOS-like protein by loss of the inhibitory peptide.
- the CAM binding site in INOS and constitutive NOS is apparently related to a similar basic region near the N terminal of P450 reductase, and may have developed from such a region in a common ancestral protein.
- the inhibition of INOS by synthetic analogs of the constitutive NOS inhibitory polypeptides is related to the ability of the synthetic polypeptides to modulate CAM binding, but does not have the simple direct relationship expected if the mechanism of peptide inhibitor action was through CAM displacement. The reverse appears to be true: inhibition/activation of NOS at this site is driven by the occupancy of key sites by the inhibitory polypeptide, and CAM binding acts to modify the binding of the intrinsic inhibitory segment to a site or sites nearby on the surface of the enzyme .
- the binding domain of the inhibitory peptide has several regions. There is at least one recognition site which binds the RRKRK (SEQ ID NO: 10) motif, and there is indication of a second such site which recognizes sequences such as EERKSYKVRF (SEQ ID NO: --) and EQHKSYKIRF (SEQ ID NO: --) which occur in the N terminal half of the ENOS and NNOS insertions; peptides which lack RRKRK (SEQ ID NO: 10) but contain these sequences can be inhibitors and/or CAM binding modulators .
Abstract
Description
Claims
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP97936100A EP0938567A1 (en) | 1996-07-12 | 1997-07-10 | Applications for regulatory region of nos isoforms |
AU38854/97A AU3885497A (en) | 1996-07-12 | 1997-07-10 | Applications for regulatory region of nos isoforms |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US08/679,006 US6150500A (en) | 1996-07-12 | 1996-07-12 | Activators of endothelial nitric oxide synthase |
US08/679,006 | 1996-07-12 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO1998002555A1 true WO1998002555A1 (en) | 1998-01-22 |
Family
ID=24725209
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US1997/012568 WO1998002555A1 (en) | 1996-07-12 | 1997-07-10 | Applications for regulatory region of nos isoforms |
Country Status (4)
Country | Link |
---|---|
US (2) | US6150500A (en) |
EP (1) | EP0938567A1 (en) |
AU (1) | AU3885497A (en) |
WO (1) | WO1998002555A1 (en) |
Cited By (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2000037653A1 (en) * | 1998-12-22 | 2000-06-29 | Board Of Regents, The University Of Texas System | Structural basis for pterin function in nitric oxide synthase |
WO2001009307A3 (en) * | 1999-07-30 | 2001-08-23 | Univ London | Screen for nitric oxide synthase modulators |
US6610649B2 (en) | 1996-09-27 | 2003-08-26 | Creative Peptides Sweden Ab | Insulin C-peptides |
WO2004012767A1 (en) * | 2002-08-02 | 2004-02-12 | Goldberg, Evgeny Danilovich | Medicinal agent and method for curing erectile dysfunction |
WO2006124820A2 (en) * | 2005-05-12 | 2006-11-23 | University Of Florida Research Foundation, Inc. | Materials and methods for regulating blood flow |
ES2445846R1 (en) * | 2010-07-21 | 2015-01-02 | Oleg Iliich Epshtein | A pharmaceutical combination composition and its use to prepare a medicament for the treatment of type 1 diabetes and metabolic disorders |
ES2446643R1 (en) * | 2010-07-21 | 2015-03-06 | Oleg Iliich Epshtein | Combined pharmaceutical compositions and their use to prepare a drug for the treatment of vertigo, motion sickness and vegetative-vascular dystonia |
Families Citing this family (33)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8680059B2 (en) * | 1998-05-20 | 2014-03-25 | Biotempt B.V. | Oligopeptide acetate and formulations thereof |
US6921751B1 (en) * | 1998-05-20 | 2005-07-26 | Erasmus Universiteit Rotterdam | Immunoregulator |
EP1138692A1 (en) | 2000-03-29 | 2001-10-04 | Erasmus Universiteit Rotterdam | Fragments of human chorionic gonadotropin (hcg) as immunoregulator |
US20040202645A1 (en) * | 2003-04-08 | 2004-10-14 | Khan Nisar Ahmed | Administration of gene-regulatory peptides |
US20050227925A1 (en) * | 2004-04-08 | 2005-10-13 | Robbert Benner | Compositions capable of reducing elevated blood urea concentration |
US7175679B2 (en) * | 2001-03-29 | 2007-02-13 | Biotempt B.V. | Oligopeptide treatment of NF-κB mediated inflammation |
US20030220258A1 (en) * | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of ischemic events |
US6844315B2 (en) | 1998-05-20 | 2005-01-18 | Erasmus Universiteit Rotterdam | Immunoregulator |
EP1300418A1 (en) * | 2001-10-04 | 2003-04-09 | Erasmus Universiteit Rotterdam | Gene regulation by oligopeptides |
US7358330B2 (en) * | 2001-03-29 | 2008-04-15 | Biotempt B.V. | Immunoregulatory compositions |
RU2181297C2 (en) | 2000-06-20 | 2002-04-20 | Эпштейн Олег Ильич | Method of treatment of pathological syndrome and medicinal agent |
GB0107563D0 (en) * | 2001-03-27 | 2001-05-16 | Amersham Pharm Biotech Uk Ltd | NO synthase assay particles and method |
US20030220259A1 (en) * | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of neurological disorders |
US20030220260A1 (en) * | 2001-12-21 | 2003-11-27 | Khan Nisar Ahmed | Peptide compositions |
US20030220261A1 (en) * | 2001-12-21 | 2003-11-27 | Khan Nisar Ahmed | Treatment of iatrogenic disease |
US20030220257A1 (en) * | 2001-12-21 | 2003-11-27 | Robbert Benner | Treatment of trauma |
US20030224995A1 (en) * | 2001-12-21 | 2003-12-04 | Khan Nisar Ahmed | Treatment of burns |
US20080242837A1 (en) * | 2001-12-21 | 2008-10-02 | Khan Nisar A | Peptide compositions |
US7786084B2 (en) * | 2001-12-21 | 2010-08-31 | Biotempt B.V. | Treatment of burns |
US20040013661A1 (en) * | 2001-12-21 | 2004-01-22 | Gert Wensvoort | Stratification |
US20080318871A1 (en) * | 2001-12-21 | 2008-12-25 | Khan Nisar A | Treatment of neurological disorders |
US7560433B2 (en) * | 2001-12-21 | 2009-07-14 | Biotempt B.V. | Treatment of multiple sclerosis (MS) |
US7501391B2 (en) * | 2001-12-21 | 2009-03-10 | Biotempt B.V. | Treatment of transplant survival |
RU2201255C1 (en) * | 2001-12-26 | 2003-03-27 | Эпштейн Олег Ильич | Medicinal agent and method of regulation of vascular tonus |
UA76641C2 (en) * | 2002-08-02 | 2006-08-15 | Олєг Ільіч Епштєйн | Homeopathic medicinal agent and method for curing diseases of prostate |
US20090227505A1 (en) * | 2004-01-07 | 2009-09-10 | Biotempt B.V. | Methods and uses for protein breakdown products |
WO2007004869A2 (en) * | 2005-07-05 | 2007-01-11 | Biotempt B.V. | Treatment of tumors |
EP1864692A1 (en) | 2006-06-07 | 2007-12-12 | Biotempt B.V. | Use of peptides for the control of radiation injury |
US20090275795A1 (en) * | 2008-05-02 | 2009-11-05 | Zassi Medical Evolutions, Inc. | Continent ostomy system with chemical neuromuscular control |
EA030566B1 (en) | 2010-07-15 | 2018-08-31 | Олег Ильич ЭПШТЕЙН | Method of increasing therapeutic effectiveness of an activated-potentiated form of an antibody to an endogenous biological molecule and pharmaceutical composition |
GB2496337A (en) | 2010-07-15 | 2013-05-08 | Oleg Lliich Epshtein | Combination pharmaceutical composition and methods of treating diseases or conditions associated with neurodegenerative diseases |
GB2496343B (en) | 2010-07-21 | 2017-11-01 | Iliich Epshtein Oleg | A method of treating attention deficit hyperactivity disorder |
USD1019804S1 (en) | 2023-04-26 | 2024-03-26 | Popsockets Llc | Expandable fidget toy |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5268465A (en) * | 1991-01-18 | 1993-12-07 | The Johns Hopkins University | Purification and molecular cloning of nitric oxide synthase |
WO1993018156A1 (en) * | 1992-03-05 | 1993-09-16 | The General Hospital Corporation | Endothelial nitric oxide synthase |
US5498539A (en) * | 1992-07-02 | 1996-03-12 | Daiichi Pharmaceutical Co., Ltd. | Bovine endothelial nitric oxide synthase nucleic acids |
JPH08503852A (en) * | 1992-11-25 | 1996-04-30 | ユニバーシティ オブ ピッツバーグ オブ ザ コモンウェルス システム オブハイヤー エデュケーション | Human inducible nitric oxide synthase cDNA clone and method for producing the same |
DE4411402A1 (en) * | 1994-03-31 | 1995-10-05 | Juergen Schrader | DNA expression vectors for use in gene therapy treatment of vascular diseases |
-
1996
- 1996-07-12 US US08/679,006 patent/US6150500A/en not_active Expired - Lifetime
-
1997
- 1997-07-10 AU AU38854/97A patent/AU3885497A/en not_active Abandoned
- 1997-07-10 EP EP97936100A patent/EP0938567A1/en not_active Withdrawn
- 1997-07-10 WO PCT/US1997/012568 patent/WO1998002555A1/en not_active Application Discontinuation
-
1999
- 1999-09-16 US US09/398,405 patent/US6750197B1/en not_active Expired - Fee Related
Non-Patent Citations (5)
Title |
---|
MASAKI NAKANE ET AL: "NOVEL POTENT AND SELECTIVE INHIBITORS OF INDUCIBLE NITRIC OXIDE SYNTHASE", MOLECULAR PHARMACOLOGY, vol. 47, no. 4, 1 April 1995 (1995-04-01), pages 831 - 834, XP000566159 * |
MAYER, BERND ET AL: "A synthetic peptide corresponding to the putative dihydrofolate reductase domain of nitric oxide synthase inhibits uncoupled NADPH oxidation", NITRIC OXIDE (1997), 1(1), 50-55 CODEN: NIOXF5;ISSN: 1089-8603, 1997, XP002046703 * |
MIRIAM PALACIOS: "Chlorpromazine inhibits both the constitutive nitric oxide synthase and the induction of nitric oxide synthase after LPS challenge", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 196, no. 1, 15 October 1993 (1993-10-15), ORLANDO, FL US, pages 280 - 286, XP002046701 * |
WATANABE, YASUO ET AL: "Identification of a specific amino acid cluster in the calmodulin -binding domain of the neuronal nitric oxide synthase", FEBS LETT. (1997), 403(1), 75-78 CODEN: FEBLAL;ISSN: 0014-5793, 1997, XP002046702 * |
WOLFF D J ET AL: "CALMODULIN-DEPENDENT NITRIC-OXIDE SYNTHASE MECHANISM OF INHIBITION BY IMIDAZOLE AND PHENYLIMIDAZOLES", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 268, no. 13, 5 May 1993 (1993-05-05), pages 9425 - 9429, XP000652112 * |
Cited By (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6610649B2 (en) | 1996-09-27 | 2003-08-26 | Creative Peptides Sweden Ab | Insulin C-peptides |
WO2000037653A1 (en) * | 1998-12-22 | 2000-06-29 | Board Of Regents, The University Of Texas System | Structural basis for pterin function in nitric oxide synthase |
WO2001009307A3 (en) * | 1999-07-30 | 2001-08-23 | Univ London | Screen for nitric oxide synthase modulators |
WO2004012767A1 (en) * | 2002-08-02 | 2004-02-12 | Goldberg, Evgeny Danilovich | Medicinal agent and method for curing erectile dysfunction |
EA008104B1 (en) * | 2002-08-02 | 2007-04-27 | Олег Ильич ЭПШТЕЙН | Medical agent and method for treating erectile dysfunction |
WO2006124820A2 (en) * | 2005-05-12 | 2006-11-23 | University Of Florida Research Foundation, Inc. | Materials and methods for regulating blood flow |
WO2006124820A3 (en) * | 2005-05-12 | 2007-01-18 | Univ Florida | Materials and methods for regulating blood flow |
US7476655B2 (en) | 2005-05-12 | 2009-01-13 | University Of Florida Research Foundation, Inc. | Materials and methods for regulating blood flow |
ES2445846R1 (en) * | 2010-07-21 | 2015-01-02 | Oleg Iliich Epshtein | A pharmaceutical combination composition and its use to prepare a medicament for the treatment of type 1 diabetes and metabolic disorders |
ES2446643R1 (en) * | 2010-07-21 | 2015-03-06 | Oleg Iliich Epshtein | Combined pharmaceutical compositions and their use to prepare a drug for the treatment of vertigo, motion sickness and vegetative-vascular dystonia |
Also Published As
Publication number | Publication date |
---|---|
US6150500A (en) | 2000-11-21 |
AU3885497A (en) | 1998-02-09 |
EP0938567A1 (en) | 1999-09-01 |
US6750197B1 (en) | 2004-06-15 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO1998002555A1 (en) | Applications for regulatory region of nos isoforms | |
Ngo et al. | Interplay between SRPK and Clk/Sty kinases in phosphorylation of the splicing factor ASF/SF2 is regulated by a docking motif in ASF/SF2 | |
AU670704B2 (en) | Peptide inhibitors of mitogenesis and motogenesis | |
Buss et al. | Myristoylated alpha subunits of guanine nucleotide-binding regulatory proteins. | |
Yamashiro et al. | Phosphorylation of non-muscle caldesmon by p34 cdc2 kinase during mitosis | |
US6280964B1 (en) | Binding sites for phosphotyrosine binding domains | |
Scott | Dissection of protein kinase and phosphatase targeting interactions | |
Kasher et al. | Design and synthesis of peptides that bind α-bungarotoxin with high affinity | |
AU2001293255A1 (en) | Caveolin peptides and their use as therapeutics | |
US7091026B2 (en) | Artificial endonuclease | |
NZ241292A (en) | Ligands for the erbb-2 transmembrane protein and pharmaceutical compositions thereof | |
Coghlan et al. | Subcellular targeting of kinases and phosphatases by association with bifunctional anchoring proteins | |
WO1994028009A1 (en) | Fragments of neurofibromin (nf1) and method to reverse activated ras induced malignant transformation in mammalian cells | |
WO1996021011A2 (en) | PEPTIDES SPECIFIC FOR THE FIRST Crk-SH3 DOMAIN | |
WO1999037768A1 (en) | Capon: a protein associated with neuronal nitric oxide synthase | |
US8916679B2 (en) | Peptides binding to the dimer interface of thymidylate synthase for the treatment of cancer | |
WO2001070770A2 (en) | Bisubstrate inhibitors of kinases | |
US20180296686A1 (en) | Peptide and peptide mimetic binding antagonists of polo-like kinase 1 polo box domain and methods of use | |
EP0831714A1 (en) | Monospecific antibodies and methods using them | |
US7091174B2 (en) | Caloxins | |
US20060019261A1 (en) | RNA-binding protein | |
WO1996041168A1 (en) | Monospecific antibodies and methods using them | |
WO1996041190A1 (en) | Monospecific antibodies and methods using them | |
WO1998016638A1 (en) | Consolidated ligands with increased affinities and methods of use thereof | |
Grant et al. | Histidine N (τ)-cyclized macrocycles as a new genre of polo-like kinase 1 polo-box domain-binding inhibitors |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AK | Designated states |
Kind code of ref document: A1 Designated state(s): AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GE GH HU IL IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZW AM AZ BY KG KZ MD RU TJ TM |
|
AL | Designated countries for regional patents |
Kind code of ref document: A1 Designated state(s): GH KE LS MW SD SZ UG ZW AT BE CH DE DK ES FI FR GB GR IE IT LU MC NL |
|
DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
WWE | Wipo information: entry into national phase |
Ref document number: 1997936100 Country of ref document: EP |
|
REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
NENP | Non-entry into the national phase |
Ref country code: JP Ref document number: 1998506314 Format of ref document f/p: F |
|
WWP | Wipo information: published in national office |
Ref document number: 1997936100 Country of ref document: EP |
|
NENP | Non-entry into the national phase |
Ref country code: CA |
|
WWW | Wipo information: withdrawn in national office |
Ref document number: 1997936100 Country of ref document: EP |