US20110159034A1 - Methods and reagents for vaccination which generate a cd8 t cell immune response - Google Patents

Methods and reagents for vaccination which generate a cd8 t cell immune response Download PDF

Info

Publication number
US20110159034A1
US20110159034A1 US12/940,627 US94062710A US2011159034A1 US 20110159034 A1 US20110159034 A1 US 20110159034A1 US 94062710 A US94062710 A US 94062710A US 2011159034 A1 US2011159034 A1 US 2011159034A1
Authority
US
United States
Prior art keywords
mva
recombinant
dna
immunisation
mice
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US12/940,627
Inventor
Andrew McMichael
Adrian V.S. Hill
Sarah C. Gilbert
Jörg Schneider
Magdalena Plebanski
Tomas Hanke
Geoffrey L. Smith
Tom Blanchard
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Oxxon Therapeutics Ltd
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=10813841&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=US20110159034(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by Individual filed Critical Individual
Priority to US12/940,627 priority Critical patent/US20110159034A1/en
Assigned to OXXON PHARMACCINES LIMITED reassignment OXXON PHARMACCINES LIMITED ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: HILL, ADRIAN V.S., BLANCHARD, TOM, MCMICHAEL, ANDREW, PLEBANSKI, MAGDALENA, SCHNEIDER, JORG, HANKE, TOMAS, SMITH, GEOFFREY L., GILBERT, SARAH C.
Assigned to OXXON THERAPEUTICS LIMITED reassignment OXXON THERAPEUTICS LIMITED CHANGE OF NAME (SEE DOCUMENT FOR DETAILS). Assignors: OXXON PHARMACCINES LIMITED
Publication of US20110159034A1 publication Critical patent/US20110159034A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/002Protozoa antigens
    • A61K39/015Hemosporidia antigens, e.g. Plasmodium antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/145Orthomyxoviridae, e.g. influenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/21Retroviridae, e.g. equine infectious anemia virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • A61P33/02Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • A61P33/06Antimalarials
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/44Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from protozoa
    • C07K14/445Plasmodium
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5256Virus expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5258Virus-like particles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55522Cytokines; Lymphokines; Interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/10011Adenoviridae
    • C12N2710/10311Mastadenovirus, e.g. human or simian adenoviruses
    • C12N2710/10341Use of virus, viral particle or viral elements as a vector
    • C12N2710/10343Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/24011Poxviridae
    • C12N2710/24041Use of virus, viral particle or viral elements as a vector
    • C12N2710/24043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/24011Poxviridae
    • C12N2710/24111Orthopoxvirus, e.g. vaccinia virus, variola
    • C12N2710/24141Use of virus, viral particle or viral elements as a vector
    • C12N2710/24143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16111Human Immunodeficiency Virus, HIV concerning HIV env
    • C12N2740/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16211Human Immunodeficiency Virus, HIV concerning HIV gagpol
    • C12N2740/16234Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • C12N2760/16122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • C12N2760/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • Plasmodium falciparum malaria causes hundreds of millions of malaria infections each year and is responsible for 1-2 million deaths annually.
  • the development of an effective vaccine against malaria is thus a major priority for global public health.
  • a considerable body of immunological research over the last twenty years had led to the identification both of candidate vaccine antigens from the parasite and immunological mechanisms on the host that are likely to protect against infection and disease.
  • This progress there is still no means of vaccinating against malaria infection which has been shown to be effective in field trials.
  • a major problem has been the identification of a means of inducing a sufficiently strong immune response in vaccinated individuals to protect against infection and disease. So, although many malaria antigens are known that might be useful in vaccinating against malaria the problem has been how to deliver such antigens or fragments of them known as epitopes, which are recognized by cells of the immune system, in a way that induces a sufficiently strong immune response of a particular type.
  • CD8+ T cells T lymphocytes of the CD8+ ve type
  • Such cells have been shown to mediate protection directly in mouse models of malaria infection (Nardin and Nussenzweig 1993).
  • T cells have also been identified in individuals naturally exposed to malaria and in volunteers immunized with irradiated sporozoite (Hill et al. 1991; Aidoo et al. 1995; Wizel et al. 1995).
  • CD8+ T cells are protective against malaria infection and disease in humans (Lalvani et al. 1994).
  • CD8+ T cells may function in more than one way.
  • the best known function is the killing or lysis of target cells bearing peptide antigen in the context of an MHC class I molecule. Hence these cells are often termed cytotoxic T lymphocytes (CTL).
  • CTL cytotoxic T lymphocytes
  • CD8+ T cells may secrete interferon gamma (IFN- ⁇ ).
  • IFN- ⁇ interferon gamma
  • the agent of fatal human malaria P. falciparum infects a restricted number of host species: humans, chimpanzees and some species of New World monkey.
  • the best non-human model of malaria is the chimpanzee because this species is closely related to humans and liver-stage infection is observed consistently unlike in the monkey hosts (Thomas et al. 1994).
  • Most laboratory studies of malaria are performed in mice, using the rodent malaria species P. berghei or P. yoelii . These latter two models are well studied and it has been shown in both that CD8+ve lymphocytes play a key role in protective immunity against sporozoite challenge.
  • mice 1995, 327-331 describe immunizing mice firstly to DNA expressing the influenza hemagglutinin (HA) antigen and then with a recombinant fowlpox vector expressing HA. An enhanced antibody response was obtained following boosting.
  • HA hemagglutinin
  • Hodge et al. (Vaccine 1997, 15: 759-768) describe the induction of lymphoproliferative T cell responses in a mouse model for cancer using human carcinoembryonic antigen (CEA) expressed in a recombinant fowl pox virus (ALVAC).
  • CEA human carcinoembryonic antigen
  • ALVAC fowl pox virus
  • Rodrigues et al. (J. Immunol. 1994, 4636-4648) describe immunizing mice with repeated doses of a recombinant influenza virus expressing an immunodominant B cell epitope of the malarial circumsporozoite (CS) protein followed by a recombinant vaccinia virus booster.
  • CS malarial circumsporozoite
  • the attenuated but replication competent strain was slightly less immunogenic for priming CD8 T cells than the wild type vaccinia strain.
  • Modified vaccinia virus Ankara is a strain of vaccinia virus which does not replicate in most cell types, including normal human tissues. MVA was derived by serial passage >500 times in chick embryo fibroblasts (CEF) of material derived from a pox lesion on a horse in Ankara, Turkey (Mayr et al. 1975). It was shown to be replication-impaired yet able to induce protective immunity against veterinary poxvirus infections (Mayr 1976). MVA was used as a human vaccine in the final stages of the smallpox eradication campaign, being administered by intracutaneous, subcutaneous and intramuscular routes to >120,000 subjects in southern Germany.
  • CEF chick embryo fibroblasts
  • MVA Newcastle disease virus
  • the safety of MVA reflects the avirulence of the virus in animal models, including irradiated mice and following intracranial administration to neonatal mice.
  • the non-replication of MVA has been correlated with the production of proliferative white plaques on chick chorioallantoic membrane, abortive infection of non-avian cells, and the presence of six genomic deletions totaling approximately 30 kb (Meyer et al. 1991).
  • the avirulence of MVA has been ascribed partially to deletions affecting host range genes K1L and C7L, although limited viral replication still occurs on human TK-143 cells and African Green Monkey CV-1 cells (Altenburger et al. 1989). Restoration of the K1L gene only partially restores MVA host range (Sutter et al. 1994). The host range restriction appears to occur during viral particle maturation, with only immature virions being observed in human HeLa cells on electron microscopy (Sutter et al. 1992). The late block in viral replication does not prevent efficient expression of recombinant genes in MVA.
  • Recombinant MVA expressing influenza nucleoprotein, influenza hemagglutinin, and SIV proteins have proved to be immunogenic and provide varying degrees of protection in animal models, although this has never been ascribed to CD8+ T lymphocytes alone (Sutter et al. 1994, Hirsch et al. 1995; Hirsch et al. 1996). Recombinant MVA is considered a promising human vaccine candidate because of these properties of safety and immunogenicity (Moss et al. 1995). Recombinant MVA containing DNA which codes for foreign antigens is described in U.S. Pat. No. 5,185,146 (Altenburger).
  • Poxviruses have evolved strategies for evasion of the host immune response that include the production of secreted proteins that function as soluble receptors for tumor necrosis factor, IL-1 ⁇ , interferon (IFN)- ⁇ / ⁇ and IFN- ⁇ , which normally have sequence similarity to the extracellular domain of cellular cytokine receptors (Symons et al. 1995; Alcami et al. 1995; Alcami et al. 1992). The most recently described receptor of this nature is a chemokine receptor (Graham et al. 1997). These viral receptors generally inhibit or subvert an appropriate host immune response, and their presence is associated with increased pathogenicity.
  • the Il-1 ⁇ receptor is an exception: its presence diminishes the host febrile response and enhances host survival in the face of infection (Alcami et al. 1996).
  • MVA lacks functional cytokine receptors for interferon ⁇ , interferon ⁇ , Tumor Necrosis Factor and CC chemokines, but it does possess the potentially beneficial IL-1 ⁇ receptor.
  • MVA is the only known strain of vaccinia to possess this cytokine receptor profile, which theoretically renders it safer and more immunogenic than other poxviruses.
  • Another replication-impaired and safe strain of vaccinia known as NYVAC is fully described in Tartaglia et al., Virology 1992, 188: 217-232).
  • non-replicating and replication-impaired strains of poxvirus provide vectors which give an extremely good boosting effect to a primed CTL response. Remarkably, this effect is significantly stronger than a boosting effect by wild type poxviruses.
  • the effect is observed with malarial and other antigens such as viral and tumor antigens, and is protective as shown in mice and non-human primate challenge experiments. Complete rather than partial protection from sporozoite challenge has been observed with the novel immunization regime.
  • FIG. 1 shows the construct used to express Ty-VLP with the malaria epitope cassette CABDHFE.
  • CTL epitopes are from P. falciparum STARP (sporozoite threonine- and asparagine-rich protein) (st), LSA-1 (liver stage antigen 1) (1s), CSP (circumsporozoite protein) (cp), TRAP (thrombospondin-related adhesive protein) (tr), LSA-3 (liver stage antigen 3) (la) and Exp-1 (exported protein 1) (ex).
  • Helper epitopes are from the P. falciparum CS protein, the M. tuberculosis 38Kd antigen and Tetanus Toxoid.
  • NANP is the antibody epitope from CS and AM is the adhesion motif from P. falciparum TRAP (Muller et al 1993). The length of the complete string is 229 amino acids.
  • FIG. 2 shows a schematic outline of the H, M and HM proteins.
  • the bar patterns on the schematic representations of the polyepitope proteins indicate the origin of the sequences. The positions of individual epitopes and their MHC restrictions are depicted above and below the proteins.
  • Pb is the only epitope derived from the protein of P. berghei . All other epitopes in the M protein originate from proteins of P. falciparum : cs—circumsporozoite protein, st—STARP, Is—LSA-1 and tr—TRAP.
  • BCG 38 kDa protein of M. tuberculosis ; TT—tetanus toxin.
  • FIG. 3 shows malaria CD8 T cell ELISPOT data following different immunisation regimes. Results are shown as the number of peptide-specific T cells per million splenocytes.
  • FIGS. 4A-4D show that malaria CD8 T cell ELISPOT ( FIGS. 4A and 4C ) and CTL levels ( FIGS. 4B and 4D ) are substantially boosted by a recombinant MVA immunisation following priming with a plasmid DNA encoding the same antigen.
  • the ELISPOT counts are presented on a logarithmic scale.
  • FIG. 5 shows the CTL responses induced in BALB/c mice to malaria and HIV epitopes by various immunisation regimes employing plasmid DNA and recombinant MVA. Levels of specific lysis at various effector to target ratios are shown.
  • FIG. 6 shows the results of ELISPOT assays performed to measure the levels of specific CD8+ T cells to the malaria epitope pb9 following different immunisation regimes.
  • ELISPOT assays were done two weeks after the last immunisation.
  • FIG. 7 shows the CTL responses against influenza NP in different mouse strains. Mice of different strains were immunised twice two weeks apart with a DNA vaccine V1J-NP encoding for the influenza nucleoprotein (open circles) or primed with the same DNA vaccine and two weeks later boosted with recombinant MVA expressing influenza virus nucleoprotein (closed circles). The CTL activity was determined in a standard 51 Cr-release assay with MHC class I-matched target cells.
  • FIGS. 8A-8H show CTL responses against different antigens induced in different inbred mouse strains. Mice were immunised with two DNA vaccine immunisations two weeks apart (open circles) or primed with a DNA vaccine and two weeks later boosted with a recombinant MVA expressing the same antigen (closed circles).
  • the strains and antigens were: FIG. 8A , C57BL/6, P. falciparum TRAP.
  • FIG. 8B DBA/2, E. coli b-galactosidase;
  • FIG. 8C BALB/c, HM epitope string CTL activity against malaria peptide (pb9); FIG.
  • FIG. 8D DBA/2, HM epitope string CTL activity against pb9
  • FIG. 8E BALB/c
  • FIG. 8F DBA/2, HM epitope string CTL activity against HIV peptide
  • FIG. 8G BALB/c
  • FIG. 8H DBA/2, tumour epitope string CTL activity against P1A-derived peptide.
  • Each curve shows the data for an individual mouse.
  • FIGS. 9A-9E show sporozoite-primed CTL responses are substantially boosted by MVA.
  • Mice were immunised with: FIG. 9A , two low doses (50+50) of irradiated sporozoites; FIG. 9B , two high doses (300+500) of sporozoites; FIG. 9D , low-dose sporozoite priming followed by boosting with MVA.PbCSP; FIG. 9E , high dose sporozoite priming followed by boosting with MVA.PbCSP.
  • CTL responses following immunisation with MVA.PbCSP are shown in FIG. 9C .
  • FIGS. 10A and 10B show CTL responses primed by plasmid DNA or recombinant Adenovirus and boosted with MVA.
  • Plasmid DNA was administered intramuscularly, MVA intravenously and Adenovirus intradermally.
  • Splenocytes were restimulated with peptide TPHPARIGL [SEQ ID NO: 69] two weeks after the last immunisation.
  • CTL activity was tested with peptide-pulsed P815 cells.
  • FIGS. 11A-11C show CTL responses in BALB/c mice primed with plasmid DNA followed by boosting with different recombinant vaccinia viruses.
  • Animals were primed with pTH.PbCSP 50 ⁇ g/mouse i.m. and two weeks later boosted with different strains of recombinant vaccina viruses (10 6 pfu per mouse i.v.) expressing PbCSP.
  • the different recombinant vaccinia virus strains were: FIG. 11A , MVA; FIG. 11B , NYVAC; and WR in Figure C.
  • the frequencies of peptide-specific CD8+ T cells were determined using the ELISPOT assay.
  • FIG. 12 shows frequencies of peptide-specific CD8+ T cells following different routes of MVA boosting. Results are shown as the number of spot-forming cells (SFC) per one million splenocytes. Each bar represents the mean number of SFCs from three mice assayed individually.
  • SFC spot-forming cells
  • FIG. 13 shows the survival rate of the two groups of mice. Sixty days after challenge eight out of ten mice were alive in the group immunised with the tumour epitopes string.
  • FIG. 14 shows results of an influenza virus challenge experiment.
  • BALB/c mice were immunised as indicated.
  • FIG. 15 shows detection of SIV-specific MHC class I-restricted CD8+ T cells using tetramers.
  • Each bar represents the percentage of CD8+ T cells specific for the Mamu-A*01/gag epitope at the indicated time point.
  • One percent of CD8 T cells corresponds to about 5000/10 6 peripheral blood lymphocytes.
  • FIG. 16 shows CTL induction in macaques following DNA/MVA immunisation.
  • PBMC from three different macaques CYD, DI and DORIS
  • peptide CTPYDINQM SEQ ID NO: 54
  • the cultures were tested for their lytic activity on peptide-pulsed autologous target cells.
  • Such diseases include but are not limited to infection and disease caused by the viruses HIV, herpes simplex, herpes zoster, hepatitis C, hepatitis B, influenza, Epstein-Barr virus, measles, dengue and HTLV-1; by the bacteria Mycobacterium tuberculosis and Listeria sp.; and by the protozoan parasites Toxoplasma and Trypanosoma ; and certain forms of cancer e.g. melanoma, cancer of the breast and cancer of the colon.
  • a surprising feature of the current invention is the finding of the very high efficacy of non-replicating agents in both priming and particularly in boosting a CD8+ T cell response.
  • the immunogenicity of CD8+ T cell induction by live replicating viral vectors has previously been found to be higher than for non-replicating agents or replication-impaired vectors. This is as would be expected from the greater amount of antigen produced by agents that can replicate in the host.
  • the greatest immunogenicity and protective efficacy is surprisingly observed with non-replicating vectors. The latter have an added advantage for vaccination in that they are in general safer for use in humans than replicating vectors.
  • the present invention provides in one aspect a kit for generating a protective CD8+ T cell immune response against at least one target antigen, which kit comprises:
  • the invention provides a method for generating a protective CD8+ T cell immune response against at least one target antigen, which method comprises administering at least one dose of component (i), followed by at least one dose of component (ii) of the kit according to the invention.
  • the source of CD8+ T cell epitopes in (i) in the method according to the invention is a non-viral vector or a non-replicating or replication-impaired viral vector, although replicating viral vectors may be used.
  • the source of CD8+ T cell epitopes in (i) is not a poxvirus vector, so that there is minimal cross-reactivity between the primer and the booster.
  • the source of CD8+ T cell epitopes in the priming composition is a nucleic acid, which may be DNA or RNA, in particular a recombinant DNA plasmid.
  • the DNA or RNA may be packaged, for example in a lysosome, or it may be in free form.
  • the source of CD8+ T cell epitopes in the priming composition is a peptide, polypeptide, protein, polyprotein or particle comprising two or more CD8+ T cell epitopes, present in a recombinant string of CD8+ T cell epitopes or in a target antigen.
  • Polyproteins include two or more proteins which may be the same, or preferably different, linked together.
  • Particularly preferred in this embodiment is a recombinant proteinaceous particle such as a Ty virus-like particle (VLP) (Burns et al. Molec. Biotechnol. 1994, 1: 137-145).
  • VLP Ty virus-like particle
  • the source of CD8+ T cell epitopes in the boosting composition is a vaccinia virus vector such as MVA or NYVAC.
  • a vaccinia virus vector such as MVA or NYVAC.
  • MVA vaccinia strain modified virus ankara
  • Alternatives to vaccinia vectors include avipox vectors such as fowlpox or canarypox vectors.
  • avipox vectors is a strain of canarypox known as ALVAC (commercially available as Kanapox), and strains derived therefrom.
  • Poxvirus genomes can carry a large amount of heterologous genetic information.
  • Other requirements for viral vectors for use in vaccines include good immunogenicity and safety.
  • MVA is a replication-impaired vaccinia strain with a good safety record. In most cell types and normal human tissues, MVA does not replicate; limited replication of MVA is observed in a few transformed cell types such as BHK21 cells.
  • vaccinia virus strains derived from MVA or independently developed strains having the features of MVA which make MVA particularly suitable for use in a vaccine, will also be suitable for use in the invention.
  • MVA containing an inserted string of epitopes has been deposited at the European Collection of Animal Cell Cultures, CAMR, Salisbury, Wiltshire SP4 0JG, UK under accession no. V97060511 on 5 Jun. 1997.
  • Alternative vectors for use in the priming composition according to the invention include a variety of different viruses, genetically disabled so as to be non-replicating or replication-restricted.
  • viruses include for example non-replicating adenoviruses such as E1 deletion mutants. Genetic disabling of viruses to produce non-replicating or replication-restricted vectors has been widely described in the literature (e.g. McLean et al. 1994).
  • non-replicating or “replication-impaired” as used herein means not capable of replication to any significant extent in the majority of normal mammalian cells or normal human cells.
  • Viruses which are non-replicating or replication-impaired may have become so naturally (i.e. they may be isolated as such from nature) or artificially e.g. by breeding in vitro or by genetic manipulation, for example deletion of a gene which is critical for replication.
  • Non-replicating or replication-impaired as used herein and as it applies to poxviruses means viruses which satisfy either or both of the following criteria:
  • poxviruses which fall within this definition are MVA, NYVAC and avipox viruses, while a virus which falls outside the definition is the attenuated vaccinia strain M7.
  • Alternative preferred viral vectors for use in the priming composition according to the invention include a variety of different viruses, genetically disabled so as to be non-replicating or replication-impaired.
  • viruses include for example non-replicating adenoviruses such as E1 deletion mutants. Genetic disabling of viruses to produce non-replicating or replication-impaired vectors has been widely described in the literature (e.g. McLean et al. 1994).
  • Suitable viral vectors for use in the priming composition are vectors based on herpes virus and Venezuelan equine encephalitis virus (VEE) (Davies et al. 1996).
  • Suitable bacterial vectors for priming include recombinant BCG and recombinant Salmonella and Salmonella transformed with plasmid DNA (Darji A et al. 1997 Cell 91: 765-775).
  • Non-viral vectors for use in the priming composition include lipid-tailed peptides known as lipopeptides, peptides fused to carrier proteins such as KLH either as fusion proteins or by chemical linkage, whole antigens with adjuvant, and other similar systems.
  • Adjuvants such as QS21 or SBAS2 (Stoute J A et al. 1997 N Engl J Medicine 226: 86-91) may be used with proteins, peptides or nucleic acids to enhance the induction of T cell responses.
  • These systems are sometimes referred to as “immunogens” rather than “vectors”, but they are vectors herein in the sense that they carry the relevant CD8+ T cell epitopes.
  • the priming and boosting compositions should not be identical in that they may both contain the priming source of CD8+ T cell epitopes as defined in (i) above and the boosting source of CD8+ T cell epitopes as defined in (ii) above.
  • a single formulation which can be used as a primer and as a booster will simplify administration. The important thing is that the primer contains at least the priming source of epitopes as defined in (i) above and the booster contains at least the boosting source of epitopes as defined in (ii) above.
  • the CD8+ T cell epitopes either present in, or encoded by the priming and boosting compositions, may be provided in a variety of different forms, such as a recombinant string of one or two or more epitopes, or in the context of the native target antigen, or a combination of both of these.
  • CD8+ T cell epitopes have been identified and can be found in the literature, for many different diseases. It is possible to design epitope strings to generate a CD8+ T cell response against any chosen antigen that contains such epitopes.
  • the epitopes in a string of multiple epitopes are linked together without intervening sequences so that unnecessary nucleic acid and/or amino acid material is avoided.
  • T helper cells In addition to the CD8+ T cell epitopes, it may be preferable to include one or more epitopes recognized by T helper cells, to augment the immune response generated by the epitope string.
  • Particularly suitable T helper cell epitopes are ones which are active in individuals of different HLA types, for example T helper epitopes from tetanus (against which most individuals will already be primed).
  • T helper epitopes from tetanus A useful combination of three T helper epitopes is employed in the examples described herein. It may also be useful to include B cell epitopes for stimulating B cell responses and antibody production.
  • a priming composition comprising a DNA plasmid vector may also comprise granulocyte macrophage-colony stimulating factor (GM-CSF), or a plasmid encoding it, to act as an adjuvant; beneficial effects are seen using GM-CSF in polypeptide form.
  • GM-CSF granulocyte macrophage-colony stimulating factor
  • compositions described herein may be employed as therapeutic or prophylactic vaccines. Whether prophylactic or therapeutic immunization is the more appropriate will usually depend upon the nature of the disease. For example, it is anticipated that cancer will be immunized against therapeutically rather than before it has been diagnosed, while anti-malaria vaccines will preferably, though not necessarily be used as a prophylactic.
  • compositions according to the invention may be administered via a variety of different routes. Certain routes may be favoured for certain compositions, as resulting in the generation of a more effective response, or as being less likely to induce side effects, or as being easier for administration.
  • the present invention has been shown to be effective with gene gun delivery, either on gold beads or as a powder.
  • the invention provides:
  • epitope strings described herein including epitope strings comprising the amino acid sequences listed in table 1 and table 2; recombinant DNA plasmids encoding the epitope strings; recombinant Ty-VLPs comprising the epitope strings; a recombinant DNA plasmid or non-replicating or replication impaired recombinant pox virus encoding the P. falciparum antigen TRAP; and a recombinant polypeptide comprising a whole or substantially whole protein antigen such as TRAP and a string of two or more epitopes in sequence such as CTL epitopes from malaria.
  • Priming Composition DNA plasmid 1 mg/ml in PBS Boosting Composition: Recombinant MVA, 10 8 ffu in PBS Protocol: Administer two doses of 1 mg of priming composition, i.m., at 0 and 3 weeks followed by two doses of booster intradermally at 6 and 9 weeks.
  • Priming Composition Ty-VLP 500 ⁇ g in PBS Boosting Composition: MVA, 10 8 ffu in PBS Protocol: Administer two doses of priming composition, i.m., at 0 and 3 weeks, then 2 doses of booster at 6 and 9 weeks.
  • MVA is given i.v. as one of most effective routes.
  • Priming Composition Protein 500 ⁇ g + adjuvant (QS-21)
  • Boosting Composition Recombinant MVA, 10 8 ffu in PBS Protocol: Administer two doses of priming composition at 0 and 3 weeks and 2 doses of booster i.d. at 6 and 9 weeks.
  • Priming Composition Adenovirus vector, 10 9 pfu in PBS Boosting Composition: Recombinant MVA, 10 8 ffu in PBS Protocol: Administer one or two doses of priming composition intradermally at 0 and 3 weeks and two doses of booster i.d. at 6 and 9 weeks.
  • the above doses and protocols may be varied to optimise protection. Doses may be given between for example, 1 to 8 weeks apart rather than 2 weeks apart.
  • the malaria epitope string was made up of a series of cassettes each encoding three epitopes as shown in Table 1, with restriction enzyme sites at each end of the cassette.
  • Each cassette was constructed from four synthetic oligonucleotides which were annealed together, ligated into a cloning vector and then sequenced to check that no errors had been introduced. Individual cassettes were then joined together as required.
  • the BamHI site at the 3′ end of cassette C was fused to the BglII site at the 5′ end of cassette A, destroying both restriction enzyme sites and encoding a two amino acid spacer (GS) between the two cassettes.
  • Cassettes B, D and H were then joined to the string in the same manner.
  • a longer string containing CABDHFE was also constructed in the same way.
  • Each cassette consists of the epitopes shown above, in the order shown, with no additional sequence between epitopes within a cassette.
  • a BglII site was added at the 5′ end and a BamHI site at the 3′ end, such that between cassettes in an epitope string the BamHI/BglII junction encodes GS.
  • All epitopes are from P. falciparum antigens except for pb9 ( P. berghei ), BCG ( M. tuberculosis ) and TT (Tetanus).
  • the amino acid and DNA sequences shown in the table have SEQ ID NOS. 1 to 40 in the order in which they appear.
  • FIG. 1 shows the construct used to express Ty-VLP with the malaria epitope cassette CABDHFE.
  • CTL epitopes are from P. falciparum STARP (sporozoite threonine- and asparagine-rich protein) (st), LSA-1 (liver stage antigen 1) (1s), CSP (circumsporozoite protein) (cp), TRAP (thrombospondin-related adhesive protein) (tr), LSA-3 (liver stage antigen 3) (la) and Exp-1 (exported protein 1) (ex).
  • Helper epitopes are from the P. falciparum CS protein, the M. tuberculosis 38Kd antigen and Tetanus Toxoid.
  • NANP is the antibody epitope from CS and AM is the adhesion motif from P. falciparum TRAP (Muller et al 1993).
  • the length of the complete string is 229 amino acids as shown in the table 1 legend, with the amino acid sequence:—MINAYLDKLISKYEDEISYIPSAEKIGSKPNDKSLYKPKDELDYKPIVQYDNFGS ASKNKEKALIIGIAGGLALLMNPNDPNRNVGSHLGNVKYLVKSLYDEHILLMD CSGSIGSDPNANPNVDPNANPNVQVHFQPLPPAVVKLQFIKANSKFIGITEGSYL NKIQNSLMEKLKELEKATSVLAGLGSNANPNANPNANPNANPDEWSPCSVTCG KGTRSRKREGSGK [SEQ ID NO: 41].
  • the HIV epitope string was also synthesised by annealing oligonucleotides. Finally the HIV and malaria epitope strings were fused by joining the BamHI site at the 3′ end of the HIV epitopes to the BglII site at the 5′ end of cassettes CAB to form the HM string (Table 2).
  • FIG. 2 shows a schematic outline of the H, M and HM proteins.
  • the bar patterns on the schematic representations of the polyepitope proteins indicate the origin of the sequences (see tables 1 and 2).
  • the positions of individual epitopes and their MHC restrictions are depicted above and below the proteins.
  • Pb is the only epitope derived from the protein of P. berghei . All other epitopes in the M protein originate from proteins of P. falciparum : cs—circumsporozoite protein, st—STARP, Is—LSA-1 and tr—TRAP.
  • BCG 38 kDa protein of M. tuberculosis ; TT—tetanus toxin.
  • tumour epitope string containing CTL epitopes was generated, similar to the malaria and HIV epitope string.
  • this tumour epitope string published murine CTL epitopes were fused together to create the tumour epitope string with the amino acid sequence: MLPYLGWLVF-AQHPNAELL-KHYLFRNL-SPSYVYHQF-IPNPLLGLD [SEQ ID NO: 65].
  • CTL epitopes shown here were fused together. The first amino acid methionine was introduced to initiate translation.
  • Vlps Ty Virus-Like Particles
  • the epitope string containing cassette CABDH was introduced into a yeast expression vector to make a C-terminal in-frame fusion to the TyA protein.
  • TyA or TyA fusion proteins are expressed in yeast from this vector, the protein spontaneously forms virus like particles which can be purified from the cytoplasm of the yeast by sucrose gradient centrifugation.
  • Recombinant Ty-VLPs were prepared in this manner and dialysed against PBS to remove the sucrose before injection (c.f. Layton et al. 1996).
  • Replication-defective recombinant Adenovirus with a deletion of the E1 genes was used in this study (McGrory et al, 1988).
  • the Adenovirus expressed E. coli ⁇ -galactosidase under the control of a CMV IE promoter.
  • 10 7 pfu of virus were administered intradermally into the ear lobe.
  • Peptides were purchased from Research Genetics (USA), dissolved at 10 mg/ml in DMSO (Sigma) and further diluted in PBS to 1 mg/ml. Peptides comprising CTL epitopes that were used in the experiments described herein are listed in table 3.
  • amino acid sequences in Table 3 have SEQ ID NOS: 66 to 73, in the order in which they appear in the Table.
  • Plasmid pTH contains the CMV IE promoter with intron A, followed by a polylinker to allow the introduction of antigen coding sequences and the bovine growth hormone transcription termination sequence.
  • the plasmid carries the ampicillin resistance gene and is capable of replication in E. coli but not mammalian cells. This was used to make DNA vaccines expressing each of the following antigens: P. berghei TRAP, P. berghei CS, P. falciparum TRAP, P.
  • Plasmid pSG2 is similar to pTH except for the antibiotic resistance gene. In pSG2 the ampicillin resistance gene of pTH has been replaced by a kanamycin resistance gene. pSG2 was used to make DNA vaccines expressing the following antigens: P. berghei PbCSP, a mouse tumour epitope string, the epitope string containing cassettes CABDH and the HM epitope string. Plasmid V1J-NP expresses influenza nucleoprotein under the control of a CMV IE promoter.
  • Plasmids CMV-TRAP and CMV-LSA-1 are similar to pTH.TRAP and pTH. LSA-1 but do not contain intron A of the CMV promoter. Plasmids RSV.TRAP and RSV.LSA-1 contain the RSV promoter, SV40 transcription termination sequence and are tetracycline resistant. For induction of ⁇ -galactosidase-specific CTL plasmid pcDNA3/His/LacZ (Invitrogen) was used. All DNA vaccines were prepared from E. coli strain DH5 ⁇ using Qiagen plasmid purification columns.
  • Recombinant MVAs were made by first cloning the antigen sequence into a shuttle vector with a viral promoter such as the plasmid pSC11 (Chakrabarti et al. 1985; Morrison et al. 1989).
  • a viral promoter such as the plasmid pSC11 (Chakrabarti et al. 1985; Morrison et al. 1989).
  • P. berghei CS and P. falciparum TRAP, influenza nucleoprotein and the HM and mouse tumour epitope polyepitope string were each expressed using the P7.5 promoter (Mackett et al. 1984), and P. berghei TRAP was expressed using the strong synthetic promoter (SSP; Carroll et al. 1995).
  • the shuttle vectors, pSC11 or pMCO3 were then used to transform cells infected with wild-type MVA so that viral sequences flanking the promoter, antigen coding sequence and marker gene could recombine with the MVA and produce recombinants.
  • Recombinant viruses express the marker gene ( ⁇ glucuronidase or ⁇ galactosidase) allowing identification of plaques containing recombinant virus.
  • Recombinants were repeatedly plaque purified before use in immunisations.
  • the recombinant NYVAC-PbCSP vaccinia was previously described (Lanar et al. 1996).
  • the wild type or Western Reserve (WR) strain of recombinant vaccinia encoding PbCSP was described previously (Satchidanandam et al. 1991).
  • Murine cells and Epstein-Barr virus transformed chimpanzee and macaque B cells were cultured in RPMI supplemented with 10% heat inactivated fetal calf serum (FCS). Splenocytes were restimulated with the peptides indicated (final concentration 1 ⁇ g/ml) in MEM medium with 10% FCS, 2 mM glutamine, 50 U/ml penicillin, 50 ⁇ M 2-mercaptoethanol and 10 mM Hepes pH7.2 (Gibco, UK).
  • mice of the strains indicated, 6-8 weeks old were purchased from Harlan Olac (Shaws Farm, Blackthorn, UK). Chimpanzees H1 and H2 were studied at the Biomedical Primate Research Centre at Rijswick, The Netherlands. Macaques were studied at the University of Oxford.
  • mice Plasmid DNA immunisations of mice were performed by intramuscular immunisation of the DNA into the musculus tibialis under anaesthesia.
  • Mouse muscle was sometimes pre-treated with 50 ⁇ l of 1 mM cardiotoxin (Latoxan, France) 5-9 days prior to immunisation as described by Davis et al (1993), but the presence or absence of such pre-treatment was not found to have any significant effect on immunogenicity or protective efficacy.
  • MVA immunisation of mice was performed by either intramuscular (i.m.), intravenous (into the lateral tail vein) (i.v.), intradermal (i.d.), intraperitoneal (i.p.) or subcutaneous (s.c.) immunisation.
  • Plasmid DNA and MVA immunisation of the chimpanzees H1 and H2 was performed under anaesthesia by intramuscular immunisation of leg muscles.
  • the plasmid DNA was co-administered with 15 micrograms of human GM-CSF as an adjuvant.
  • Recombinant MVA administration to the chimpanzees was by intramuscular immunisation under veterinary supervision.
  • Recombinant human GM-CSF was purchased from Sandoz (Camberley, UK).
  • plasmid DNA immunisations using a gene gun DNA was precipitated onto gold particles.
  • two different types of gene guns were used, the Acell and the Oxford Bioscience device (PowderJect Pharmaceuticals, Oxford, UK).
  • CD8+ T cells were quantified in the spleens of immunised mice without in vitro restimulation using the peptide epitopes indicated and the ELISPOT assay as described by Miyahara et at (1993). Briefly, 96-well nitrocellulose plates (Miliscreen MAHA, Millipore, Bedford UK) were coated with 15 ⁇ g/ml of the anti-mouse interferon- ⁇ monoclonal antibody R4 (EACC) in 50 ⁇ l of phosphate-buffered saline (PBS). After overnight incubation at 4° C. the wells were washed once with PBS and blocked for 1 hour at room temperature with 100 ⁇ l RPMI with 10% FCS.
  • EACC anti-mouse interferon- ⁇ monoclonal antibody
  • Splenocytes from immunised mice were resuspended to 1 ⁇ 10 7 cells/ml and placed in duplicate in the antibody coated wells and serially diluted. Peptide was added to each well to a final concentration of 1 ⁇ g/ml. Additional wells without peptide were used as a control for peptide-dependence of interferon- ⁇ secretion. After incubation at 37° C. in 5% CO 2 for 12-18 hours the plates were washed 6 times with PBS and water. The wells were then incubated for 3 hours at room temperature with a solution of 1 ⁇ g/ml of biotinylated anti-mouse interferon- ⁇ monoclonal antibody XMG1.2 (Pharmingen, CA, USA) in PBS.
  • ELISPOT assays on the chimpanzee peripheral blood lymphocytes were performed using a very similar method employing the assay and reagents developed to detect human CD8 T cells (Mabtech, Sweden).
  • CTL assays were performed using chromium labelled target cells as indicated and cultured mouse spleen cells as effector cells as described by Allsopp et al. (1996).
  • CTL assays using chimpanzee or macaque cells were performed as described for the detection of human CTL by Hill et al. (1992) using EBV-transformed autologous chimpanzee or macaque B cell lines as target cells.
  • mice were challenged with 2000 (BALB/c) or 200 (C57BL/6) sporozoites of the P. berghei ANKA strain in 200 ml RPMI by intravenous inoculation as described (Lanar et al. 1996). These sporozoites were dissected from the salivary glands of Anopheles stephensi mosquitoes maintained at 18° C. for 20-25 days after feeding on infected mice. Blood-stage malaria infection, indicating a failure of the immunisation, was detected by observing the appearance of ring forms of P. berghei in Giemsa-stained blood smears taken at 5-12 days post-challenge.
  • the chimpanzees were challenged with 20,000 P. falciparum sporozoites of the NF54 strain dissected from the salivary glands of Anopheles gambiae mosquitoes, by intravenous inoculation under anaesthesia. Blood samples from these chimpanzees were examined daily from day 5 after challenge by microscopy and parasite culture, in order to detect the appearance of low levels of P. falciparum parasites in the peripheral blood.
  • mice were challenged with 1 ⁇ 10 5 P815 cells in 200 ⁇ l of PBS by intravenous inoculation. Animals were monitored for survival.
  • mice were challenged with 100 haemagglutinating units (HA) of influenza virus A/PR/8/34 by intranasal inoculation. Following challenge the animals were weighed daily and monitored for survival.
  • HA haemagglutinating units
  • Tetrameric complexes consisting of Mamu-A*01-heavy chain and ⁇ 2 -microglobulin were made as described by Ogg et al (1998).
  • DNA coding for the leaderless extracellular portion of the Mamu-A*01 MHC class I heavy chain was PCR-amplified from cDNA using 5′ primer MamuNdeI: 5′-CCT GAC TCA GAC CAT ATG GGC TCT CAC TCC ATG [SEQ ID NO: 74] and 3′ primer: 5′-GTG ATA AGC TTA ACG ATG ATT CCA CAC CAT TTT CTG TGC ATC CAG AAT ATG ATG CAG GGA TCC CTC CCA TCT CAG GGT GAG GGG C [SEQ ID NO: 75].
  • the former primer contained a NdeI restriction site, the latter included a HindIII site and encoded for the bioinylation enzyme BirA substrate peptide.
  • PCR products were digested with NdeI and HindIII and ligated into the same sites of the polylinker of bacterial expression vector pGMT7.
  • the rhesus monkey gene encoding a leaderless ⁇ 2 -microglobulin was PCR amplified from a cDNA clone using primers B2 MBACK: 5′-TCA GAC CAT ATG TCT CGC TCC GTG GCC [SEQ ID NO: 76] and B2MFOR: 5′-TCA GAC AAG CTT TTA CAT GTC TCG ATC CCA C [SEQ ID NO: 77] and likewise cloned into the NdeI and HindIII sites of pGMT7. Both chains were expressed in E.
  • coli strain BL-21 purified from inclusion bodies, refolded in the presence of peptide CTPYDINQM [SEQ ID NO: 54], biotinylated using the BirA enzyme (Avidity) and purified with FPLC and monoQ ion exchange columns.
  • the amount of biotinylated refolded MHC-peptide complexes was estimated in an ELISA assay, whereby monomeric complexes were first captured by conformation sensitive monoclonal antibody W6/32 and detected by alkaline phosphatase (AP)—conjugated streptavidin (Sigma) followed by colorimetric substrate for AP.
  • AP alkaline phosphatase
  • mice intramuscularly with 50 micrograms of a plasmid encoding the CS protein produced moderate levels of CD8+ cells and CTL activity in the spleens of these mice after a single injection ( FIGS. 3 , 4 A- 4 D).
  • FIG. 3 shows malaria CD8 T cell ELISPOT data following different immunisation regimes. Results are shown as the number of peptide-specific T cells per million splenocytes. Mice were immunised either with the PbCSP-plasmid DNA or the PbCSP-MVA virus or combinations of the two as shown on the X axis, at two week intervals and the number of splenocytes specific for the pb9 malaria epitope assayed two weeks after the last immunisation. Each point represents the number of spot-forming cells (SFCs) measured in an individual mouse. The highest level of CD8+ T cells was induced by priming with the plasmid DNA and boosting with the recombinant MVA virus.
  • SFCs spot-forming cells
  • FIGS. 4A-4D shows that malaria CD8 T cell ELISPOT and CTL levels are substantially boosted by a recombinant MVA immunisation following priming with a plasmid DNA encoding the same antigen.
  • a AND C. CD8+ T cell responses were measured in BALB/c mice using the g-interferon ELISPOT assay on fresh splenocytes incubated for 18 h with the K d restricted peptide SYIPSAEKI [SEQ ID NO: 67] from P. berghei CSP and the L d restricted peptide TPHPARIGL [SEQ ID NO: 69] from E. coli ⁇ -galactosidase.
  • mice were immunised with plasmid DNA expressing either P. berghei CSP and TRAP, PbCSP alone, the malaria epitope cassette including the P. berghei CTL epitope (labelled pTH.M), or ⁇ -galactosidase.
  • ELISPOT and CTL levels measured in mice 23 days after one DNA immunisation are shown in A and B respectively.
  • the same assays were performed with animals that received additionally 1 ⁇ 10 7 ffu of recombinant MVA expressing the same antigen(s) two weeks after the primary immunisation.
  • the ELISPOT and CTL levels in these animals are shown in C and D respectively. Each bar represents data from an individual animal.
  • Table 4 shows the results of ELISPOT assays performed to measure the levels of specific CD8+ T cells to HIV and malaria epitopes following different immunisation regimes of plasmid DNA and MVA as indicated.
  • the numbers are spot-forming cells per million splenocytes.
  • the HM epitope string is illustrated in FIG. 2 .
  • BALB/c mice were used in all cases.
  • the malaria epitope was pb9 as in FIGS. 2 and 3 .
  • the HIV epitope was RGPGRAFVTI [SEQ ID NO: 51].
  • the immunisation doses were 50 ⁇ g of plasmid DNA or 10 7 focus-forming units (ffu) of recombinant MVA. All immunisations were intramuscular. The interval between immunisations 1 and 2 was from 14-21 days in all cases.
  • FIG. 5 shows the CTL responses induced in BALB/c mice to malaria and HIV epitopes by various immunisation regimes employing plasmid DNA and recombinant MVA.
  • Mice were immunised intramuscularly as described in the legend to table 3 and in methods.
  • High levels of CTL (>30% specific lysis at effector/target ration of 25:1) were observed to both the malaria and HIV epitopes only after priming with plasmid DNA and boosting with the recombinant MVA.
  • the antigen used in this experiment is the HIV-malaria epitope string.
  • the recombinant MVA is denoted MVA.HM and the plasmid DNA expressing this epitope string is denoted pTH.HM.
  • Levels of specific lysis at various effector to target ratios are shown. These were determined after 5 days in vitro restimulation of splenocytes with the two peptides pb9 and RGPGRAFVTI [SEQ ID
  • Ty-VLPs Ty-virus like particles
  • lipid-tailed malaria peptides both gave good CTL induction but Ty-VLPs were better in that they required only a single immunising dose for good CTL induction.
  • two doses of Ty particles fail to induce significant protection against sporozoite challenge (Table 7, line 1).
  • Immunisation with a recombinant modified vaccinia Ankara virus encoding the circumsporozoite protein of P. berghei also generates good levels of CTL.
  • a much higher level of CD8+ T cell response is achieved by a first immunisation with the Ty-VLP followed by a second immunisation with the MVA CS vaccine (Table 5).
  • the ELISPOT levels are measured on un-restimulated cells and the CTL activity, indicated as specific lysis at an effector to target ratio of 40:1, on cells restimulated with pb9 peptide in vitro for 5-7 days. Both represent mean levels of three mice. BALB/c mice were used in all cases.
  • the immunisation doses were 50 ⁇ g of Ty-VLP or 10 7 ffu (foci forming units) of recombinant MVA. All immunisations were intramuscular. The interval between immunisations 1 and 2 was from 14-21 days.
  • MVA.HM includes cassettes CAB. Priming of an Immune Response with DNA Delivered by a Gene Gun and Boosting with Recombinant MVA
  • the immunogenicity of the three immunisation regimens was analysed using ELISPOT assays.
  • the highest frequency of specific T cells was observed with two gene gun immunisations followed by an MVA i.v. boost and the intramuscular DNA injection followed an MVA i.v. boost ( FIG. 6 ).
  • FIG. 6 shows the results of ELISPOT assays performed to measure the levels of specific CD8+ T cells to the malaria epitope pb9 following different immunisation regimes.
  • ELISPOT assays were done two weeks after the last immunisation.
  • FIG. 7 shows the CTL responses against influenza NP in different mouse strains.
  • Mice of different strains were immunised twice two weeks apart with a DNA vaccine V1J-NP encoding for the influenza nucleoprotein (open circles) or primed with the same DNA vaccine and two weeks later boosted with recombinant MVA expressing influenza virus nucleoprotein (closed circles).
  • Two weeks after the last immunisation splenocytes were restimulated in vitro with the respective peptides (Table 3).
  • the CTL activity was determined in a standard 51 Cr-release assay with MHC class I-matched target cells.
  • mice of different strains were immunised with different antigens using two DNA immunisations and compared with DNA/MVA immunisations.
  • the antigens used were E. coli ⁇ -galactosidase, the malaria/HIV epitope string, a murine tumour epitope string and P. falciparum TRAP.
  • the DNA-priming/MVA-boosting regimen induced higher levels of CTL in all the different mouse strains and antigen combinations tested ( FIGS. 8A-8H ).
  • FIGS. 8A-8H show CTL responses against different antigens induced in different inbred mouse strains.
  • Mice were immunised with two DNA vaccine immunisations two weeks apart (open circles) or primed with a DNA vaccine and two weeks later boosted with a recombinant MVA expressing the same antigen (closed circles).
  • the strains and antigens were: C57BL/6; P. falciparum TRAP in A. DBA/2 ; E. coli b-galactosidase in B. BALB/c; HM epitope string CTL activity against malaria peptide (pb9) in C. DBA/2; HM epitope string CTL activity against pb9 in D.
  • Sporozoites can Efficiently Prime an Immune Response that is Boostable by MVA
  • FIGS. 9A-9E show sporozoite-primed CTL responses are substantially boosted by MVA.
  • Mice were immunised with two low doses (50+50) of irradiated sporozoites in FIG. 9A ; two high doses (300+500) of sporozoites in FIG. 9B ; mice were boosted with MVA.PbCSP following low-dose sporozoite priming in FIG. 9D ; high dose sporozoite priming in FIG. 9E .
  • CTL responses following immunisation with MVA.PbCSP are shown in FIG. 9C .
  • the prime-boost immunisation regimen has been exemplified using plasmid DNA and recombinant Ty-VLP as priming agent.
  • plasmid DNA and recombinant Ty-VLP as priming agent.
  • Replication-deficient recombinant Adenovirus expressing E. coli ⁇ -galactosidase (Adeno-GAL) was used.
  • Groups of BALB/c mice were immunised with plasmid DNA followed by MVA or with Adenovirus followed by MVA. All antigen delivery systems used encoded E. coli ⁇ -galactosidase.
  • Priming a CTL response with plasmid DNA or Adenovirus and boosting with MVA induces similar levels of CTL ( FIGS. 10A-10B ).
  • FIGS. 10A-10B show CTL responses primed by plasmid DNA or recombinant Adenovirus and boosted with MVA.
  • Plasmid DNA was administered intramuscularly, MVA intravenously and Adenovirus intradermally.
  • Splenocytes were restimulated with peptide TPHPARIGL [SEQ ID NO: 69] two weeks after the last immunisation.
  • CTL activity was tested with peptide-pulsed P815 cells.
  • the prime boosting strategy was tested using different strains of recombinant vaccina viruses to determine whether the different strains with strains differing in their replication competence may differ in their ability to boost a DNA-primed CTL response.
  • Boosting with replication-defective recombinant vaccinia viruses such as MVA and NYVAC resulted in the induction of stronger CTL responses compared to CTL responses following boosting with the same dose of replication competent WR vaccinia virus ( FIGS. 11A-11C ).
  • FIGS. 11A-11C show CTL responses in BALB/c mice primed with plasmid DNA followed by boosting with different recombinant vaccinia viruses.
  • Animals were primed with pTH.PbCSP 50 ⁇ g/mouse i.m. and two weeks later boosted with different strains of recombinant vaccina viruses (10 6 pfu per mouse i.v.) expressing PbCSP.
  • the different recombinant vaccinia virus strains were MVA in FIG. 11A ; NYVAC in FIG. 11B and WR in FIG. 11C .
  • the superiority of replication-impaired vaccinia strains over replicating strains was found in a further experiment.
  • the frequencies of peptide-specific CD8+ T cells were determined using the ELISPOT assay. The frequencies were: MVA 1103+/ ⁇ 438, NYVAC 826+/ ⁇ 249 and WR 468+/ ⁇ 135.
  • Recombinant canary pox virus (rCPV) or fowl pox virus (rFVP) are made using shuttle vectors described previously (Taylor et al. Virology 1992, 187: 321-328 and Taylor et al. Vaccine 1988, 6: 504-508).
  • the strategy for these shuttle vectors is to insert the gene encoding the protein of interest preceded by a vaccinia-specific promoter between two flanking regions comprised of sequences derived from the CPV or FPV genome. These flanking sequences are chosen to avoid insertion into essential viral genes.
  • Recombinant CPV or FPV are generated by in vivo recombination in permissive avian cell lines i.e. primary chicken embryo fibroblasts.
  • Any protein sequence of antigens or epitope strings can be expressed using fowl pox or canary pox virus.
  • Recombinant CPV or FPV is characterised for expression of the protein of interest using antigen-specific antibodies or including an antibody epitope into the recombinant gene.
  • Recombinant viruses are grown on primary CEF.
  • An immune response is primed using plasmid DNA as described in Materials and Methods. This plasmid DNA primed immune response is boosted using 10 7 ffu/pfu of rCPV or rFPV inoculated intravenously, intradermally or intramuscularly.
  • CD8+ T cell responses are monitored and challenges are performed as described herein.
  • mice were challenged by intravenous injection with 2000 or 200 P. berghei sporozoites. This leads to infection of liver cells by the sporozoites. However, in the presence of a sufficiently strong T lymphocyte response against the intrahepatic parasite no viable parasite will leave the liver and no blood-stage parasites will be detectable. Blood films from challenged mice were therefore assessed for parasites by microscopy 5-12 days following challenge.
  • mice immunised twice with a mixture of two plasmid DNAs encoding the CS protein and the TRAP antigen, respectively, of P. berghei were not protected against sporozoite challenge.
  • Mice immunised twice with a mixture of recombinant MVA viruses encoding the same two antigens were not protected against sporozoite challenge.
  • Mice immunised first with the two recombinant MVAs and secondly with the two recombinant plasmids were also not protected against sporozoite challenge.
  • all 15 mice immunised first with the two plasmid DNAs and secondly with the two recombinant MVA viruses were completely resistant to sporozoite challenge (Table 6 A and B).
  • mice were then immunised with each antigen separately (Table 6 B). All 10 mice immunised first with the CS plasmid DNA and secondly with the CS MVA virus were completely protected against sporozoite challenge. Fourteen out of 16 mice immunised first with the TRAP plasmid DNA vaccine and secondly with the TRAP MVA virus were protected against sporozoite challenge. Therefore the CS antigen alone is fully protective when the above immunisation regime is employed and the TRAP antigen is substantially protective with the same regime.
  • CD8+ T lymphocyte clones against the major CD8+ T cell epitope in the P. berghei CS protein can protect against sporozoite challenge.
  • a plasmid DNA and a recombinant MVA encoding only this nine amino acid sequence from P. berghei as a part of a string of epitopes Table 6 B. (All the other epitopes were from micro-organisms other than P. berghei ).
  • the interval between immunisations 1 and 2 was from 14-21 days in all cases. Challenges were performed at 18-29 days after the last immunisation by i.v. injection of 2000 P. berghei sporozoites and blood films assessed at 5, 8 and 10 days post challenge.
  • CSP and TRAP indicate the entire P. berghei antigen and ‘ epitope’ indicates the cassettes of epitopes shown in table 1 containing only a single P. berghei K d ⁇ restricted nonamer CTL epitope. Note that in experiment B immunisation with the epitope string alone yields 100% protection.
  • mice immunised twice with recombinant Ty-VLPs encoding pb9 were fully susceptible to infection.
  • mice immunised twice with the recombinant MVA encoding the full CS protein were fully susceptible to infection.
  • the mice immunised once with the Ty-VLP and subsequently once with the recombinant MVA showed an 85% reduction in malaria incidence when boosted with MVA expressing the full length CS protein, and 95% when MVA expressing the HM epitope string which includes pb9 was used to boost (Table 7).
  • mice were immunised with the DNA vaccine encoding P. berghei CS protein and boosted with either (i) recombinant MVA encoding this antigen; (ii) recombinant wild-type vaccinia virus (Western Reserve strain) encoding the same antigen (Satchidanandam et al. 1991), or (iii) recombinant NYVAC(COPAK) virus (Lanar et al. 1996) encoding the same malaria antigen.
  • Table 8 Results of a challenge experiment using different immunisation regimes of plasmid DNA and various vaccinia recombinants as indicated.
  • BALB/c mice were used in all cases.
  • the immunisation doses were 50 ⁇ g of plasmid DNA or 10 6 ffu/pfu of recombinant MVA or 10 4 ffu/pfu of recombinant wild type (WR) vaccinia or 10 6 ffu/pfu of recombinant NYVAC. Because the WR strain will replicate in the host and the other strains will not, in this experiment a lower dose of WR was used. The interval between immunisations 1 and 2 was 23 days.
  • mice were immunised with the DNA vaccine encoding P. berghei CS protein and boosted with either (i) recombinant MVA encoding this antigen; (ii) recombinant WR vaccinia virus encoding the same antigen or (iii) recombinant NYVAC(COPAK) virus encoding the same malaria antigen, all at 10 6 ffu/pfu.
  • a high and statistically significant degree of protection was observed with boosting with recombinant NYVAC (80%) or recombinant MVA (66%).
  • a low and non-significant level of protection (26%) was observed by boosting with the WR recombinant vaccinia virus (Table 9).
  • the immunisation doses were 50 ⁇ g of plasmid DNA or 10 6 ffu/pfu of recombinant MVA or recombinant wild type (WR) vaccinia or recombinant NYVAC.
  • the interval between immunisations 1 and 2 was 23 days.
  • Challenges were performed at 28 days after the last immunisation by i.v. injection of 2000 P. berghei sporozoites and blood films assessed at 7, 9 and 11 days post challenge.
  • PbCSP indicates the entire P. berghei antigen and NP the nucleoprotein antigen of influenza virus (used as a control antigen).
  • the control immunisation was with a plasmid DNA vector expressing ⁇ -galactosidase followed by MVA.NP.
  • Intravenous injection of recombinant MVA is not a preferred route for immunising humans and not feasible in mass immunisations. Therefore different routes of MVA boosting were tested for their immunogenicity and protective efficacy.
  • mice were primed with plasmid DNA i.m. Two weeks later they were boosted with MVA administered via the following routes: intravenous (i.v.), subcutaneous (s.c.), intraperitoneal (i.p.), intramuscular (i.p.) and intradermal (i.d.). Two weeks after this boost peptide-specific CD8+ T cells were determined in an ELISPOT assay. The most effective route which induced the highest levels were i.v. and i.d inoculation of MVA. The other routes gave moderate to poor responses ( FIG. 12 ).
  • FIG. 12 shows frequencies of peptide-specific CD8+ T cells following different routes of MVA boosting. Results are shown as the number of spot-forming cells (SFC) per one million splenocytes. Mice were primed with plasmid DNA and two weeks later boosted with MVA via the indicated routes. The number of splenocytes specific for the SYIPSAEKI [SEQ ID NO: 67] peptide was determined in INF- ⁇ ELISPOT assays two weeks after the last immunisation. Each bar represents the mean number of SFCs from three mice assayed individually.
  • SFC spot-forming cells
  • Boosting via the i.v. route was compared with the i.d. and i.m route in a challenge experiment.
  • the i.d route gave high levels of protection (80% protection).
  • 50% of the animals were protected.
  • Complete protection was achieved with MVA boost administered i.v. (Table 10)
  • mice malaria challenge experiments described so far using plasmid DNA to prime an immune response used intramuscular injection of plasmid DNA.
  • C57BL/6 mice are very susceptible to P. berghei sporozoite challenge.
  • C57BL/6 mice were immunised using the DNA-MVA prime boost regime with both pre-erythrocytic antigens PbCSP and PbTRAP, and challenged with either 200 or 1000 infectious sporozoites per mouse. (Two hundred sporozoites corresponds to more than twice the dose required to induce infection in this strain). All ten mice challenged with 200 sporozoites showed sterile immunity. Even the group challenged with 1000 sporozoites, 60% of the mice were protected (Table 12). All the na ⁇ ve C57BL/6 mice were infected after challenge.
  • the two challenge models were the P815 tumour model and the influenza A virus challenge model. In both model systems CTL have been shown to mediate protection.
  • mice were immunised with a combination of DNA followed by MVA expressing a tumour epitope string or the HM epitope string. Two weeks after the last immunisation the mice were challenged intravenously with 10 5 P815 cells. Following this challenge the mice were monitored regularly for the development of tumour-related signs and survival.
  • mice Groups of BALB/c mice were immunised with three gene gun immunisations with plasmid DNA, two intramuscular plasmid DNA injections, one i.m. DNA injection followed by one MVA.NP boost i.v. or two gene gun immunisations followed by one MVA.NP boost i.v. Plasmid DNA and recombinant MVA expressed the influenza virus nucleoprotein. Two weeks after the last immunisation the mice were challenged intranasally with 100 HA of influenza A/PR/8/34 virus. The animals were monitored for survival daily after challenge.
  • FIG. 14 shows results of an influenza virus challenge experiment.
  • BALB/c mice were immunised as indicated.
  • groups of 10 BALB/c mice were immunised with MVA.NP i.v. alone, three times with the gene gun, two times with the gene gun followed by one MVA.NP boost i.v. and two i.m injections of V1J-NP followed by one MVA.NP boost. Two weeks after the last immunisation the mice were challenged with 100 HA units of influenza A/PR/8/34 virus.
  • the vaccine consisted of a string of CTL epitopes derived from HIV and SIV sequences ( FIG. 2 ), in plasmid DNA or MVA, denoted DNA.H and MVA.H respectively.
  • the use of defined CTL epitopes in a polyepitope string allows testing for SIV specific CTL in macaques. Due to the MHC class I restriction of the antigenic peptides, macaques were screened for their MHC class I haplotype and Mamu-A*01-positive animals were selected for the experiments described.
  • week 0 DNA (8 ⁇ g, i.d., gene gun)
  • week 8 DNA (8 ⁇ g, i.d., gene gun)
  • week 17 MVA (5 ⁇ 10 8 pfu, i.d.)
  • week 22 MVA (5 ⁇ 10 8 pfu, i.d.)
  • PBMC isolated from each bleed were re-stimulated in vitro with a peptide encoded in the epitope string and tested for their ability to recognise autologous peptide-loaded target cells in a chromium release cytotoxicity assay. Additionally, freshly isolated PBMC were stained for antigen specific CD8+ T cells using tetramers.
  • FIG. 15 shows detection of SIV-specific MHC class I-restricted CD8+ T cells using tetramers.
  • Three Mamu-A*A01-positive macaques were immunised with plasmid DNA (gene gun) followed by MVA boosting as indicated. Frequencies of Mamu-A*A01/CD8 double-positive T cells were identified following FACS analysis.
  • Each bar represents the percentage of CD8+ T cells specific for the Mamu-A*01/gag epitope at the indicated time point.
  • One percent of CD8 T cells corresponds to about 5000/10 6 peripheral blood lymphocytes.
  • the levels of epitope-specific CD8 T cells in the peripheral blood of these macaques are at least as high as the levels observed in the spleens of immunised and protected mice in the malaria studies.
  • FIG. 16 shows CTL induction in macaques following DNA/MVA immunisation.
  • PBMC from three different macaques CYD, DI and DORIS
  • peptide CTPYDINQM SEQ ID NO: 54
  • the cultures were tested for their lytic activity on peptide-pulsed autologous target cells. Strong CTL activity was observed.
  • Chimp H1 received an initial immunisation with 500 ⁇ g of a plasmid expressing Plasmodium falciparum TRAP from the CMV promoter without intron A, CMV-TRAP.
  • Chimp H2 received the same dose of CMV-LSA-1, which expresses the C-terminal portion of the LSA-1 gene of P. falciparum .
  • H1 received CMV-TRAP as before, plus pTH-TRAP, which expresses TRAP using the CMV promoter with intron A, leading to a higher expression level.
  • H1 also received RSV-LSA-1, which expresses the C-terminal portion of LSA-1 from the RSV promoter.
  • H2 received CMV-LSA-1, pTH-LSA-1 and RSV-TRAP at the second, third and fourth immunisations. The dose was always 500 ⁇ g of each plasmid.
  • Both animals were subsequently immunised with three doses of 10 8 ffu of a recombinant MVA virus encoding the P. falciparum TRAP antigen over a 6 week period.
  • T cell responses to the TRAP antigen were detectable in both chimpanzees using an ELISPOT assay to whole TRAP protein bound to latex beads. This assay detects both CD4+ and CD8+ T cell responses.
  • Specific CD8+ T responses were searched for with a series of short 8-11 amino acid peptides in both immunised chimpanzees. Such analysis for CD8+ T cell responses indicated that CD8+ T cells were detectable only in the chimpanzee H1.
  • the target epitope of these CD8+ T lymphocytes was an 11 amino acid peptide from TRAP, tr57, of sequence KTASCGVWDEW [SEQ ID NO: 78].
  • These CD8+ T cells from H1 had lytic activity against autologous target cells pulsed with the tr57 peptide and against autologous target cells infected with the recombinant PfTRAP-MVA virus.
  • a high precursor frequency of these specific CD8+ T cells of about 1 per 500 lymphocytes was detected in the peripheral blood of this chimpanzee H1 using an ELISPOT assay two months following the final MVA immunisation. No specific CD8+ T cell response was clearly detected in the chimpanzee H2, which was not primed with a plasmid DNA expressing TRAP.
  • the levels induced are comparable to those found in SIV-infected animals.
  • the data from the chimpanzee studies indicate that the same immunisation regime can induce a strong CD8+ T lymphocyte response against P. falciparum in higher primates with some evidence of protection against P. falciparum sporozoite challenge.
  • Ty-VLPs have previously been reported to induce good levels of CD8+ T cell responses against the P. berghei rodent malaria (Allsopp et al. 1995) but alone this construct is not protective. It has now been found that subsequent immunisation with recombinant MVA boosts the CD8+ T cell response very substantially and generates a high level of protection (Table 7).
  • Recombinant MVA viruses have not been assessed for efficacy as malaria vaccines previously. Recombinant MVA alone was not significantly protective, nor was priming with recombinant MVA followed by a second immunisation with recombinant plasmid DNA. However, a second immunisation with the recombinant MVA following an initial immunisation with either Ty-VLPs or plasmid DNA yielded impressive levels of protection. Non-recombinant MVA virus has been safely used to vaccinate thousands of human against smallpox and appears to have an excellent safety profile. The molecular basis of the increased safety and immunogenicity of this strain of vaccinia virus is being elucidated by detailed molecular studies (Meyer et al. 1991; Sutter at al. 1994).
  • Plasmid DNA has previously been tested as a malaria vaccine for the P. yoelii rodent malaria. High levels of, but not complete, protection is seen in some strains but in other strains of mice little or no protection was observed even after multiple immunisations (Doolan et al. 1996). Although plasmid DNA has been proposed as a method of immunisation against P. falciparum , success has not previously been achieved. The evidence provided here is the first evidence to show that plasmid DNA may be used in an immunisation regime to induce protective immunity against the human malaria parasite P. falciparum.
  • the plasmid DNA encoding the same epitope string as 3. 5.
  • the plasmid DNAs and MVA encoding HIV epitopes for human class I molecules could be used in either prophylactic or therapeutic immunisation against HIV infection.
  • the critical step in this immunisation regimen is the use of non-replicating or replication-impaired recombinant poxviruses to boost a pre-existing CTL response.
  • CTL responses can be primed using different antigen delivery systems such as a DNA vaccine i.d. and i.m, a recombinant Ty-VLP, a recombinant adenovirus and irradiated sporozoites. This is supported by the data presented on the generation of a CD8+ T cell response against HIV, influenza virus and tumours.
  • CD8+ T cell immune response is important
  • Induction of protective CTL responses against influenza A virus has been demonstrated in FIG. 14 .
  • the immunisation regime described herein is expected to be of value in immunising against forms of cancer where CD8+ T cell responses plays a protective role.
  • the induction of protective CTL responses using the DNA prime MVA boost regime against tumours is shown in FIG. 13 .
  • Specific examples in humans include melanoma, cancer of the breast and cancer of the colon.

Abstract

New methods and reagents for vaccination are described which generate a CD8 T cell immune response against malarial and other antigens such as viral and tumour antigens. Novel vaccination regimes are described which employ a priming composition and a boosting composition, the boosting composition comprising a non-replicating or replication-impaired pox virus vector carrying at least one CD8 T cell epitope which is also present in the priming composition.

Description

    RELATED APPLICATIONS
  • This application is a continuation of U.S. application Ser. No. 12/221,498, filed Aug. 4, 2008, pending, which is a continuation of U.S. application Ser. No. 10/653,624, filed Sep. 2, 2003, abandoned, which is a divisional of U.S. application Ser. No. 09/454,204, filed on Dec. 9, 1999, issued as U.S. Pat. No. 6,663,871, which is a continuation of, and claims priority to, International Application No. PCT/GB98/01681, filed 9 Jun. 1998 which designates the United States, and which is a continuing application of GB9711957.2 filed 9 Jun. 1997. The entire teachings of the above applications are incorporated herein by reference.
  • BACKGROUND OF THE INVENTION
  • A general problem in vaccinology has been an inability to generate high levels of CD8 T cells by immunization. This has impeded the development of vaccines against several diseases including malaria.
  • Plasmodium falciparum malaria causes hundreds of millions of malaria infections each year and is responsible for 1-2 million deaths annually. The development of an effective vaccine against malaria is thus a major priority for global public health. A considerable body of immunological research over the last twenty years had led to the identification both of candidate vaccine antigens from the parasite and immunological mechanisms on the host that are likely to protect against infection and disease. However, despite this progress there is still no means of vaccinating against malaria infection which has been shown to be effective in field trials.
  • A major problem has been the identification of a means of inducing a sufficiently strong immune response in vaccinated individuals to protect against infection and disease. So, although many malaria antigens are known that might be useful in vaccinating against malaria the problem has been how to deliver such antigens or fragments of them known as epitopes, which are recognized by cells of the immune system, in a way that induces a sufficiently strong immune response of a particular type.
  • It has been known for many years that it is possible to protect individuals by immunizing them with very large doses of irradiated malaria sporozoite given by bites from infected mosquitoes. Although this is a wholly impractical method of mass vaccination it has provided a model for analyzing the immune responses that might be mediating protective immunity against sporozoite infection (Nardin and Nussenzweig 1993).
  • A considerable amount of research over the last decade or more has indicated that a major protective immune response against the early pre-erythrocytic stage of P. falciparum malaria is mediated by T lymphocytes of the CD8+ ve type (CD8+ T cells). Such cells have been shown to mediate protection directly in mouse models of malaria infection (Nardin and Nussenzweig 1993). Such T cells have also been identified in individuals naturally exposed to malaria and in volunteers immunized with irradiated sporozoite (Hill et al. 1991; Aidoo et al. 1995; Wizel et al. 1995). There is much indirect evidence that such CD8+ T cells are protective against malaria infection and disease in humans (Lalvani et al. 1994).
  • CD8+ T cells may function in more than one way. The best known function is the killing or lysis of target cells bearing peptide antigen in the context of an MHC class I molecule. Hence these cells are often termed cytotoxic T lymphocytes (CTL). However, another function, perhaps of greater protective relevance in malaria infections is the ability of CD8+ T cells to secrete interferon gamma (IFN-γ). Thus assays of lytic activity and of IFN-γ release are both of value in measuring a CD8+ T cell immune response. In malaria these CD8+ve cells can protect by killing the parasite at the early intrahepatic stage of malaria infection before any symptoms of disease are produced (Seguin et al. 1994).
  • The agent of fatal human malaria, P. falciparum infects a restricted number of host species: humans, chimpanzees and some species of New World monkey. The best non-human model of malaria is the chimpanzee because this species is closely related to humans and liver-stage infection is observed consistently unlike in the monkey hosts (Thomas et al. 1994). Because of the expense and limited availability of chimpanzees most laboratory studies of malaria are performed in mice, using the rodent malaria species P. berghei or P. yoelii. These latter two models are well studied and it has been shown in both that CD8+ve lymphocytes play a key role in protective immunity against sporozoite challenge.
  • Previous studies have assessed a large variety of means of inducing CD8+ T cell responses against malaria. Several of these have shown some level of CD8+ T cell response and partial protection against malaria infection in the rodent models (e.g. Li et al. 1993; Sedegah et al. 1994; Lanar et al. 1996). However, an effective means of immunizing with subunit vaccines by the induction of sufficiently high levels of CD8+ T lymphocytes to protect effectively against malaria sporozoite infection has not previously been demonstrated.
  • In recent years improved immune responses generated to potential vaccines have been sought by varying the vectors used to deliver the antigen. There is evidence that in some instances antibody responses are improved by using two different vectors administered sequentially as prime and boost. A variety of combinations of prime and boost have been tested in different potential vaccine regimes.
  • Leong et al. (Vaccines 1995, 327-331) describe immunizing mice firstly to DNA expressing the influenza hemagglutinin (HA) antigen and then with a recombinant fowlpox vector expressing HA. An enhanced antibody response was obtained following boosting.
  • Richmond et al. (Virology 1997, 230: 265-274) describe attempts to raise neutralizing antibodies against HIV-1 env using DNA priming and recombinant vaccinia virus boosting. Only low levels of antibody responses were observed with this prime boost regime and the results were considered disappointing.
  • Fuller et al. (Vaccine 1997, 15:924-926 and Immunol Cell Biol 1997, 75:389-396) describe an enhancement of antibody responses to DNA immunization of macaques by using a booster immunization with replicating recombinant vaccinia viruses. However, this did not translate into enhanced protective efficacy as a greater reduction in viral burden and attenuation of CD4 T cell loss was seen in the DNA primed and boosted animals.
  • Hodge et al. (Vaccine 1997, 15: 759-768) describe the induction of lymphoproliferative T cell responses in a mouse model for cancer using human carcinoembryonic antigen (CEA) expressed in a recombinant fowl pox virus (ALVAC). The authors primed an immune response with CEA-recombinant replication competent vaccinia viruses of the Wyeth or WR strain and boosted the response with CEA-recombinant ALVAC. This led to an increase in T cell proliferation but did not result in enhanced protective efficacy if compared to three wild type recombinant immunizations (100% protection), three recombinant ALVAC-CEA immunizations (70% protection) or WR prime followed by two ALVAC-CEA immunizations (63% protection).
  • Thus some studies of heterologous prime-boost combination have found some enhancement of antibody and lymphoproliferative responses but no significant effect on protective efficacy in an animal model. CD8 T cells were not measured in these studies. The limited enhancement of antibody response probably simply reflects the fact that antibodies to the priming immunogen will often reduce the immunogenicity of a second immunization with the same immunogen, while boosting with a different carrier will in part overcome this problem. This mechanism would not be expected to be significantly affected by the order of immunization.
  • Evidence that a heterologous prime boost immunization regime might affect CD8 T cell responses was provided by Li et al. (1993). They described partial protective efficacy induced in mice against malaria sporozoite challenge by administering two live viral vectors, a recombinant replicating influenza virus followed by a recombinant replicating vaccinia virus encoding a malaria epitope. Reversing the order of immunization led to loss of all protective efficacy and the authors suggested that this might be related to infection of liver cells by vaccinia, resulting in localization of CTLs in the liver to protect against the hepatocytic stages of malaria parasites.
  • Rodrigues et al. (J. Immunol. 1994, 4636-4648) describe immunizing mice with repeated doses of a recombinant influenza virus expressing an immunodominant B cell epitope of the malarial circumsporozoite (CS) protein followed by a recombinant vaccinia virus booster. The use of a wild type vaccinia strain and an attenuated but replication-competent vaccinia strain in the booster yielded very similar levels of partial protection. However the attenuated but replication competent strain was slightly less immunogenic for priming CD8 T cells than the wild type vaccinia strain.
  • Murata et al. (Cell. Immunol. 1996, 173: 96-107) reported enhanced CD8 T cell responses after priming with replicating recombinant influenza viruses and boosting with a replicating strain of vaccinia virus and suggested that the partial protection observed in the two earlier studies was attributable to this enhanced CD8 T cell induction.
  • Thus these three studies together provide evidence that a booster immunization with a replicating recombinant vaccinia virus may enhance to some degree CD8 T cell induction following priming with a replicating recombinant influenza virus. However, there are two limitations to these findings in terms of their potential usefulness. Firstly, the immunogenicity induced was only sufficient to achieve partial protection against malaria and even this was dependent on a highly immunogenic priming immunization with an unusual replicating recombinant influenza virus. Secondly, because of the potential and documented side-effects of using these replicating viruses as immunogens these recombinant vectors are not suitable for general human use as vaccines.
  • Modified vaccinia virus Ankara (MVA) is a strain of vaccinia virus which does not replicate in most cell types, including normal human tissues. MVA was derived by serial passage >500 times in chick embryo fibroblasts (CEF) of material derived from a pox lesion on a horse in Ankara, Turkey (Mayr et al. 1975). It was shown to be replication-impaired yet able to induce protective immunity against veterinary poxvirus infections (Mayr 1976). MVA was used as a human vaccine in the final stages of the smallpox eradication campaign, being administered by intracutaneous, subcutaneous and intramuscular routes to >120,000 subjects in southern Germany. No significant side effects were recorded, despite the deliberate targeting of vaccination to high risk groups such as those with eczema (Mayr et al. 1978; Stickl et al. 1974; Mahnel et al. 1994). The safety of MVA reflects the avirulence of the virus in animal models, including irradiated mice and following intracranial administration to neonatal mice. The non-replication of MVA has been correlated with the production of proliferative white plaques on chick chorioallantoic membrane, abortive infection of non-avian cells, and the presence of six genomic deletions totaling approximately 30 kb (Meyer et al. 1991). The avirulence of MVA has been ascribed partially to deletions affecting host range genes K1L and C7L, although limited viral replication still occurs on human TK-143 cells and African Green Monkey CV-1 cells (Altenburger et al. 1989). Restoration of the K1L gene only partially restores MVA host range (Sutter et al. 1994). The host range restriction appears to occur during viral particle maturation, with only immature virions being observed in human HeLa cells on electron microscopy (Sutter et al. 1992). The late block in viral replication does not prevent efficient expression of recombinant genes in MVA. Recombinant MVA expressing influenza nucleoprotein, influenza hemagglutinin, and SIV proteins have proved to be immunogenic and provide varying degrees of protection in animal models, although this has never been ascribed to CD8+ T lymphocytes alone (Sutter et al. 1994, Hirsch et al. 1995; Hirsch et al. 1996). Recombinant MVA is considered a promising human vaccine candidate because of these properties of safety and immunogenicity (Moss et al. 1995). Recombinant MVA containing DNA which codes for foreign antigens is described in U.S. Pat. No. 5,185,146 (Altenburger).
  • Poxviruses have evolved strategies for evasion of the host immune response that include the production of secreted proteins that function as soluble receptors for tumor necrosis factor, IL-1β, interferon (IFN)-α/β and IFN-γ, which normally have sequence similarity to the extracellular domain of cellular cytokine receptors (Symons et al. 1995; Alcami et al. 1995; Alcami et al. 1992). The most recently described receptor of this nature is a chemokine receptor (Graham et al. 1997). These viral receptors generally inhibit or subvert an appropriate host immune response, and their presence is associated with increased pathogenicity. The Il-1β receptor is an exception: its presence diminishes the host febrile response and enhances host survival in the face of infection (Alcami et al. 1996). We have discovered that MVA lacks functional cytokine receptors for interferon γ, interferon αβ, Tumor Necrosis Factor and CC chemokines, but it does possess the potentially beneficial IL-1β receptor. MVA is the only known strain of vaccinia to possess this cytokine receptor profile, which theoretically renders it safer and more immunogenic than other poxviruses. Another replication-impaired and safe strain of vaccinia known as NYVAC is fully described in Tartaglia et al., Virology 1992, 188: 217-232).
  • It has long been recognized that live viruses have some attractive features as recombinant vaccine vectors including a high capacity for foreign antigens and fairly good immunogenicity for cellular immune responses (Ellis 1988 new technologies for making vaccines. In: Vaccines. Editors: Plotkin S A and Mortimer E A. W B Saunders, Philadelphia, page 568; Woodrow G C 1977. In: New Generation Vaccines lid 2 Edition. Editors: Levine M M, Woodrow G C, Kaper J B, Cobon G, page 33). This has led to attempts to attenuate the virulence of such live vectors in various ways including reducing their replication capacity (Tartaglia J et al. 1992 Virology 188: 217-232). However such a reduction in replication reduces the amount of antigen produced by the virus and thereby would be expected to reduce vaccine immunogenicity. Indeed attenuation of replicating vaccinia strains has previously been shown to lead to some substantial reductions in antibody responses (Lee M S et al, 1992 J Virology 66: 2617-2630). Similarly the non-replicating fowlpox vector was found to be less immunogenic for antibody production and less protective than a replicating wild-type vaccinia strain in a rabies study (Taylor J et al. 1991 Vaccine 9: 190-193).
  • SUMMARY OF THE INVENTION
  • It has now been discovered that non-replicating and replication-impaired strains of poxvirus provide vectors which give an extremely good boosting effect to a primed CTL response. Remarkably, this effect is significantly stronger than a boosting effect by wild type poxviruses. The effect is observed with malarial and other antigens such as viral and tumor antigens, and is protective as shown in mice and non-human primate challenge experiments. Complete rather than partial protection from sporozoite challenge has been observed with the novel immunization regime.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG. 1 shows the construct used to express Ty-VLP with the malaria epitope cassette CABDHFE. CTL epitopes are from P. falciparum STARP (sporozoite threonine- and asparagine-rich protein) (st), LSA-1 (liver stage antigen 1) (1s), CSP (circumsporozoite protein) (cp), TRAP (thrombospondin-related adhesive protein) (tr), LSA-3 (liver stage antigen 3) (la) and Exp-1 (exported protein 1) (ex). Helper epitopes are from the P. falciparum CS protein, the M. tuberculosis 38Kd antigen and Tetanus Toxoid. NANP is the antibody epitope from CS and AM is the adhesion motif from P. falciparum TRAP (Muller et al 1993). The length of the complete string is 229 amino acids.
  • FIG. 2 shows a schematic outline of the H, M and HM proteins. The bar patterns on the schematic representations of the polyepitope proteins indicate the origin of the sequences. The positions of individual epitopes and their MHC restrictions are depicted above and below the proteins. Pb is the only epitope derived from the protein of P. berghei. All other epitopes in the M protein originate from proteins of P. falciparum: cs—circumsporozoite protein, st—STARP, Is—LSA-1 and tr—TRAP. BCG—38 kDa protein of M. tuberculosis; TT—tetanus toxin.
  • FIG. 3 shows malaria CD8 T cell ELISPOT data following different immunisation regimes. Results are shown as the number of peptide-specific T cells per million splenocytes.
  • FIGS. 4A-4D show that malaria CD8 T cell ELISPOT (FIGS. 4A and 4C) and CTL levels (FIGS. 4B and 4D) are substantially boosted by a recombinant MVA immunisation following priming with a plasmid DNA encoding the same antigen. The ELISPOT counts are presented on a logarithmic scale.
  • FIG. 5 shows the CTL responses induced in BALB/c mice to malaria and HIV epitopes by various immunisation regimes employing plasmid DNA and recombinant MVA. Levels of specific lysis at various effector to target ratios are shown.
  • FIG. 6 shows the results of ELISPOT assays performed to measure the levels of specific CD8+ T cells to the malaria epitope pb9 following different immunisation regimes. Groups of BALB/c mice (n=3) were immunised as indicated (g.g.=gene gun). The time between all immunisations was 14 days. ELISPOT assays were done two weeks after the last immunisation.
  • FIG. 7 shows the CTL responses against influenza NP in different mouse strains. Mice of different strains were immunised twice two weeks apart with a DNA vaccine V1J-NP encoding for the influenza nucleoprotein (open circles) or primed with the same DNA vaccine and two weeks later boosted with recombinant MVA expressing influenza virus nucleoprotein (closed circles). The CTL activity was determined in a standard 51Cr-release assay with MHC class I-matched target cells.
  • FIGS. 8A-8H show CTL responses against different antigens induced in different inbred mouse strains. Mice were immunised with two DNA vaccine immunisations two weeks apart (open circles) or primed with a DNA vaccine and two weeks later boosted with a recombinant MVA expressing the same antigen (closed circles). The strains and antigens were: FIG. 8A, C57BL/6, P. falciparum TRAP. FIG. 8B, DBA/2, E. coli b-galactosidase; FIG. 8C, BALB/c, HM epitope string CTL activity against malaria peptide (pb9); FIG. 8D, DBA/2, HM epitope string CTL activity against pb9; FIG. 8E, BALB/c; HM epitope string CTL activity against HIV peptide; FIG. 8F, DBA/2, HM epitope string CTL activity against HIV peptide; FIG. 8G, BALB/c, tumour epitope string CTL activity against P1A-derived peptide; and in FIG. 8H, DBA/2, tumour epitope string CTL activity against P1A-derived peptide. Each curve shows the data for an individual mouse.
  • FIGS. 9A-9E show sporozoite-primed CTL responses are substantially boosted by MVA. Mice were immunised with: FIG. 9A, two low doses (50+50) of irradiated sporozoites; FIG. 9B, two high doses (300+500) of sporozoites; FIG. 9D, low-dose sporozoite priming followed by boosting with MVA.PbCSP; FIG. 9E, high dose sporozoite priming followed by boosting with MVA.PbCSP. CTL responses following immunisation with MVA.PbCSP are shown in FIG. 9C.
  • FIGS. 10A and 10B show CTL responses primed by plasmid DNA or recombinant Adenovirus and boosted with MVA. Groups of BALB/c mice (n=3) were primed with plasmid DNA (FIG. 10A) or recombinant Adenovirus expressing β-galactosidase (FIG. 10 B). Plasmid DNA was administered intramuscularly, MVA intravenously and Adenovirus intradermally. Splenocytes were restimulated with peptide TPHPARIGL [SEQ ID NO: 69] two weeks after the last immunisation. CTL activity was tested with peptide-pulsed P815 cells.
  • FIGS. 11A-11C show CTL responses in BALB/c mice primed with plasmid DNA followed by boosting with different recombinant vaccinia viruses. Animals were primed with pTH.PbCSP 50 μg/mouse i.m. and two weeks later boosted with different strains of recombinant vaccina viruses (106 pfu per mouse i.v.) expressing PbCSP. The different recombinant vaccinia virus strains were: FIG. 11A, MVA; FIG. 11B, NYVAC; and WR in Figure C. The frequencies of peptide-specific CD8+ T cells were determined using the ELISPOT assay.
  • FIG. 12 shows frequencies of peptide-specific CD8+ T cells following different routes of MVA boosting. Results are shown as the number of spot-forming cells (SFC) per one million splenocytes. Each bar represents the mean number of SFCs from three mice assayed individually.
  • FIG. 13 shows the survival rate of the two groups of mice. Sixty days after challenge eight out of ten mice were alive in the group immunised with the tumour epitopes string.
  • FIG. 14 shows results of an influenza virus challenge experiment. BALB/c mice were immunised as indicated. GG=gene gun immunisations, im=intramuscular injection, iv=intravenous injection. Survival of the animals was monitored daily after challenge.
  • FIG. 15 shows detection of SIV-specific MHC class I-restricted CD8+ T cells using tetramers. Each bar represents the percentage of CD8+ T cells specific for the Mamu-A*01/gag epitope at the indicated time point. One percent of CD8 T cells corresponds to about 5000/106 peripheral blood lymphocytes.
  • FIG. 16 shows CTL induction in macaques following DNA/MVA immunisation. PBMC from three different macaques (CYD, DI and DORIS) were isolated at week 18, 19 and 23 and were restimulated with peptide CTPYDINQM [SEQ ID NO: 54] in vitro. After two restimulations with peptide CTPYDINQM [SEQ ID NO: 54] the cultures were tested for their lytic activity on peptide-pulsed autologous target cells.
  • DETAILED DESCRIPTION OF THE INVENTION
  • It is an aim of this invention to identify an effective means of immunizing against malaria. It is a further aim of this invention to identify means of immunizing against other diseases in which CD8+ T cell responses play a protective role. Such diseases include but are not limited to infection and disease caused by the viruses HIV, herpes simplex, herpes zoster, hepatitis C, hepatitis B, influenza, Epstein-Barr virus, measles, dengue and HTLV-1; by the bacteria Mycobacterium tuberculosis and Listeria sp.; and by the protozoan parasites Toxoplasma and Trypanosoma; and certain forms of cancer e.g. melanoma, cancer of the breast and cancer of the colon.
  • We describe here a novel method of immunizing that generated very high levels of CD8+ T cells and was found to be capable of inducing unprecedented complete protection against P. berghei sporozoite challenge. The same approach was tested in higher primates and found to be highly immunogenic in this species also, and was found to induce partial protection against P. falciparum challenge. Induction of protective immune responses has also been demonstrated in two additional mouse models of viral infection and cancer.
  • We show further than the novel immunization regime that is described here is also effective in generating strong CD8+ T cell responses against HIV epitopes. Considerable evidence indicates that the generation of such CD8+ T cell responses can be expected to be of value in prophylactic or therapeutic immunization against this viral infection and disease (Gallimore et at 1995; Ada 1996). We demonstrate that strong CD8+ T cell responses may be generated against epitopes from both HIV and malaria using an epitope string with sequences from both of these micro-organisms. The success in generating enhanced immunogenicity against both HIV and malaria epitopes, and also against influenza and tumor epitopes, indicates that this novel immunization regime can be effective generally against many infectious pathogens and also in non-infectious diseases where the generation of a strong CD8+ T cell response may be of value.
  • A surprising feature of the current invention is the finding of the very high efficacy of non-replicating agents in both priming and particularly in boosting a CD8+ T cell response. In general the immunogenicity of CD8+ T cell induction by live replicating viral vectors has previously been found to be higher than for non-replicating agents or replication-impaired vectors. This is as would be expected from the greater amount of antigen produced by agents that can replicate in the host. Here however we find that the greatest immunogenicity and protective efficacy is surprisingly observed with non-replicating vectors. The latter have an added advantage for vaccination in that they are in general safer for use in humans than replicating vectors.
  • The present invention provides in one aspect a kit for generating a protective CD8+ T cell immune response against at least one target antigen, which kit comprises:
      • (i) a priming composition comprising a source of one or more CD8+ T cell epitopes of the target antigen, together with a pharmaceutically acceptable carrier; and
      • (ii) a boosting composition comprising a source of one or more CD8+ T cell epitopes of the target antigen, including at least one CD8+ T cell epitope which is the same as a CD8+ T cell epitope of the priming composition, wherein the source of CD8+ T cell epitopes is a non-replicating or replication-impaired recombinant poxvirus vector, together with a pharmaceutically acceptable carrier; with the proviso that if the source of epitopes in (i) is a viral vector, the viral vector in (ii) is derived from a different virus.
  • In another aspect the invention provides a method for generating a protective CD8+ T cell immune response against at least one target antigen, which method comprises administering at least one dose of component (i), followed by at least one dose of component (ii) of the kit according to the invention.
  • Preferably, the source of CD8+ T cell epitopes in (i) in the method according to the invention is a non-viral vector or a non-replicating or replication-impaired viral vector, although replicating viral vectors may be used.
  • Preferably, the source of CD8+ T cell epitopes in (i) is not a poxvirus vector, so that there is minimal cross-reactivity between the primer and the booster.
  • In one preferred embodiment of the invention, the source of CD8+ T cell epitopes in the priming composition is a nucleic acid, which may be DNA or RNA, in particular a recombinant DNA plasmid. The DNA or RNA may be packaged, for example in a lysosome, or it may be in free form.
  • In another preferred embodiment of the invention, the source of CD8+ T cell epitopes in the priming composition is a peptide, polypeptide, protein, polyprotein or particle comprising two or more CD8+ T cell epitopes, present in a recombinant string of CD8+ T cell epitopes or in a target antigen. Polyproteins include two or more proteins which may be the same, or preferably different, linked together. Particularly preferred in this embodiment is a recombinant proteinaceous particle such as a Ty virus-like particle (VLP) (Burns et al. Molec. Biotechnol. 1994, 1: 137-145).
  • Preferably, the source of CD8+ T cell epitopes in the boosting composition is a vaccinia virus vector such as MVA or NYVAC. Most preferred is the vaccinia strain modified virus ankara (MVA) or a strain derived therefrom. Alternatives to vaccinia vectors include avipox vectors such as fowlpox or canarypox vectors. Particularly suitable as an avipox vector is a strain of canarypox known as ALVAC (commercially available as Kanapox), and strains derived therefrom.
  • Poxvirus genomes can carry a large amount of heterologous genetic information. Other requirements for viral vectors for use in vaccines include good immunogenicity and safety. MVA is a replication-impaired vaccinia strain with a good safety record. In most cell types and normal human tissues, MVA does not replicate; limited replication of MVA is observed in a few transformed cell types such as BHK21 cells. It has now been shown, by the results described herein, that recombinant MVA and other non-replicating or replication-impaired strains are surprisingly and significantly better than conventional recombinant vaccinia vectors at generating a protective CD8+ T cell response, when administered in a boosting composition following priming with a DNA plasmid, a recombinant Ty-VLP or a recombinant adenovirus.
  • It will be evident that vaccinia virus strains derived from MVA, or independently developed strains having the features of MVA which make MVA particularly suitable for use in a vaccine, will also be suitable for use in the invention.
  • MVA containing an inserted string of epitopes (MVA-HM, which is described in the Examples) has been deposited at the European Collection of Animal Cell Cultures, CAMR, Salisbury, Wiltshire SP4 0JG, UK under accession no. V97060511 on 5 Jun. 1997.
  • Alternative vectors for use in the priming composition according to the invention include a variety of different viruses, genetically disabled so as to be non-replicating or replication-restricted. Such viruses include for example non-replicating adenoviruses such as E1 deletion mutants. Genetic disabling of viruses to produce non-replicating or replication-restricted vectors has been widely described in the literature (e.g. McLean et al. 1994).
  • The term “non-replicating” or “replication-impaired” as used herein means not capable of replication to any significant extent in the majority of normal mammalian cells or normal human cells. Viruses which are non-replicating or replication-impaired may have become so naturally (i.e. they may be isolated as such from nature) or artificially e.g. by breeding in vitro or by genetic manipulation, for example deletion of a gene which is critical for replication. There will generally be one or a few cell types in which the viruses can be grown, such as CEF cells for MVA.
  • Replication of a virus is generally measured in two ways: 1) DNA synthesis and 2) viral titre. More precisely, the term “non-replicating or replication-impaired” as used herein and as it applies to poxviruses means viruses which satisfy either or both of the following criteria:
      • 1) exhibit a 1 log(10 fold) reduction in DNA synthesis compared to the Copenhagen strain of vaccinia virus in MRC-5 cells (a human cell line);
      • 2) exhibit a 2 log reduction in viral titre in HELA cells (a human cell line) compared to the Copenhagen strain of vaccinia virus.
  • Examples of poxviruses which fall within this definition are MVA, NYVAC and avipox viruses, while a virus which falls outside the definition is the attenuated vaccinia strain M7.
  • Alternative preferred viral vectors for use in the priming composition according to the invention include a variety of different viruses, genetically disabled so as to be non-replicating or replication-impaired. Such viruses include for example non-replicating adenoviruses such as E1 deletion mutants. Genetic disabling of viruses to produce non-replicating or replication-impaired vectors has been widely described in the literature (e.g. McLean et al. 1994).
  • Other suitable viral vectors for use in the priming composition are vectors based on herpes virus and Venezuelan equine encephalitis virus (VEE) (Davies et al. 1996). Suitable bacterial vectors for priming include recombinant BCG and recombinant Salmonella and Salmonella transformed with plasmid DNA (Darji A et al. 1997 Cell 91: 765-775).
  • Alternative suitable non-viral vectors for use in the priming composition include lipid-tailed peptides known as lipopeptides, peptides fused to carrier proteins such as KLH either as fusion proteins or by chemical linkage, whole antigens with adjuvant, and other similar systems. Adjuvants such as QS21 or SBAS2 (Stoute J A et al. 1997 N Engl J Medicine 226: 86-91) may be used with proteins, peptides or nucleic acids to enhance the induction of T cell responses. These systems are sometimes referred to as “immunogens” rather than “vectors”, but they are vectors herein in the sense that they carry the relevant CD8+ T cell epitopes.
  • There is no reason why the priming and boosting compositions should not be identical in that they may both contain the priming source of CD8+ T cell epitopes as defined in (i) above and the boosting source of CD8+ T cell epitopes as defined in (ii) above. A single formulation which can be used as a primer and as a booster will simplify administration. The important thing is that the primer contains at least the priming source of epitopes as defined in (i) above and the booster contains at least the boosting source of epitopes as defined in (ii) above.
  • The CD8+ T cell epitopes either present in, or encoded by the priming and boosting compositions, may be provided in a variety of different forms, such as a recombinant string of one or two or more epitopes, or in the context of the native target antigen, or a combination of both of these. CD8+ T cell epitopes have been identified and can be found in the literature, for many different diseases. It is possible to design epitope strings to generate a CD8+ T cell response against any chosen antigen that contains such epitopes. Advantageously, the epitopes in a string of multiple epitopes are linked together without intervening sequences so that unnecessary nucleic acid and/or amino acid material is avoided. In addition to the CD8+ T cell epitopes, it may be preferable to include one or more epitopes recognized by T helper cells, to augment the immune response generated by the epitope string. Particularly suitable T helper cell epitopes are ones which are active in individuals of different HLA types, for example T helper epitopes from tetanus (against which most individuals will already be primed). A useful combination of three T helper epitopes is employed in the examples described herein. It may also be useful to include B cell epitopes for stimulating B cell responses and antibody production.
  • The priming and boosting compositions described may advantageously comprise an adjuvant. In particular, a priming composition comprising a DNA plasmid vector may also comprise granulocyte macrophage-colony stimulating factor (GM-CSF), or a plasmid encoding it, to act as an adjuvant; beneficial effects are seen using GM-CSF in polypeptide form.
  • The compositions described herein may be employed as therapeutic or prophylactic vaccines. Whether prophylactic or therapeutic immunization is the more appropriate will usually depend upon the nature of the disease. For example, it is anticipated that cancer will be immunized against therapeutically rather than before it has been diagnosed, while anti-malaria vaccines will preferably, though not necessarily be used as a prophylactic.
  • The compositions according to the invention may be administered via a variety of different routes. Certain routes may be favoured for certain compositions, as resulting in the generation of a more effective response, or as being less likely to induce side effects, or as being easier for administration. The present invention has been shown to be effective with gene gun delivery, either on gold beads or as a powder.
  • In further aspects, the invention provides:
      • a method for generating a protective CD8+ T cell immune response against a pathogen or tumor, which method comprises administering at least one dose of a recombinant DNA plasmid encoding at least one CD8+ T cell epitope or antigen of the pathogen or cancer, followed by at least one dose of a non-replicating or replication-impaired recombinant pox virus encoding the same epitope or antigen;
      • a method for generating a protective CD8+ T cell immune response against a pathogen or tumor, which method comprises administering at least one dose of a recombinant protein or particle comprising at least one epitope or antigen of the pathogen or cancer, followed by at least one dose of a recombinant MVA vector encoding the same epitope or antigen;
      • the use of a recombinant non-replicating or replication-impaired pox virus vector in the manufacture of a medicament for boosting a CD8+ T cell immune response;
      • the use of an MVA vector in the manufacture of a medicament for boosting a CD8+ T cell immune response;
      • a medicament for boosting a primed CD8+ T cell response against at least one target antigen or epitope, comprising a source of one or more CD8+ T cell epitopes of the target antigen, wherein the source of CD8+ T cell epitopes is a non-replicating or a replication-impaired recombinant poxvirus vector, together with a pharmaceutically acceptable carrier; and
      • the priming and/or boosting compositions described herein, in particulate form suitable for delivery by a gene gun; and methods of immunization comprising delivering the compositions by means of a gene gun.
  • Also provided by the invention are: the epitope strings described herein, including epitope strings comprising the amino acid sequences listed in table 1 and table 2; recombinant DNA plasmids encoding the epitope strings; recombinant Ty-VLPs comprising the epitope strings; a recombinant DNA plasmid or non-replicating or replication impaired recombinant pox virus encoding the P. falciparum antigen TRAP; and a recombinant polypeptide comprising a whole or substantially whole protein antigen such as TRAP and a string of two or more epitopes in sequence such as CTL epitopes from malaria.
  • Example Formulations and Immunization Protocols Formulation 1
  • Priming Composition: DNA plasmid 1 mg/ml in PBS
    Boosting Composition: Recombinant MVA, 108 ffu in PBS

    Protocol: Administer two doses of 1 mg of priming composition, i.m., at 0 and 3 weeks followed by two doses of booster intradermally at 6 and 9 weeks.
  • Formulation 2
  • Priming Composition: Ty-VLP 500 μg in PBS
    Boosting Composition: MVA, 108 ffu in PBS

    Protocol: Administer two doses of priming composition, i.m., at 0 and 3 weeks, then 2 doses of booster at 6 and 9 weeks. For tumor treatment, MVA is given i.v. as one of most effective routes.
  • Formulation 3
  • Priming Composition: Protein 500 μg + adjuvant (QS-21)
    Boosting Composition: Recombinant MVA, 108 ffu in PBS

    Protocol: Administer two doses of priming composition at 0 and 3 weeks and 2 doses of booster i.d. at 6 and 9 weeks.
  • Formulation 4
  • Priming Composition: Adenovirus vector, 109 pfu in PBS
    Boosting Composition: Recombinant MVA, 108 ffu in PBS

    Protocol: Administer one or two doses of priming composition intradermally at 0 and 3 weeks and two doses of booster i.d. at 6 and 9 weeks.
    The above doses and protocols may be varied to optimise protection. Doses may be given between for example, 1 to 8 weeks apart rather than 2 weeks apart.
  • The invention will now be further described in the examples which follow.
  • EXAMPLES Example 1 Materials and Methods Generation of the Epitope Strings
  • The malaria epitope string was made up of a series of cassettes each encoding three epitopes as shown in Table 1, with restriction enzyme sites at each end of the cassette. Each cassette was constructed from four synthetic oligonucleotides which were annealed together, ligated into a cloning vector and then sequenced to check that no errors had been introduced. Individual cassettes were then joined together as required. The BamHI site at the 3′ end of cassette C was fused to the BglII site at the 5′ end of cassette A, destroying both restriction enzyme sites and encoding a two amino acid spacer (GS) between the two cassettes. Cassettes B, D and H were then joined to the string in the same manner. A longer string containing CABDHFE was also constructed in the same way.
  • TABLE 1
    CTL Epitopes of the Malaria (M) String
    HLA
    Cassette Epitope Amino acid Sequence DNA sequence Type restriction
    A Ls8 KPNDKSLY AAGCCGAACGACAAGTCCTTGTAT CTL B35
    SEQ ID NO.: 2 SEQ ID NO.: 1
    Cp26 KPKDELDY AAACCTAAGGACGAATTGGACTAC CTL B35
    SEQ ID NO.: 4 SEQ ID NO.: 3
    Ls6 KPIVQYDNF AAGCCAATCGTTCAATACGACAACTTC CTL B53
    SEQ ID NO.: 6 SEQ ID NO.: 5
    B Tr42/43 ASKNKEKALII GCCTCCAAGAACAAGGAAAAGGCTTTGAT CTL B8
    SEQ ID NO.: 8 CATC
    SEQ ID NO.: 7
    Tr39 GIAGGLALL GGTATCGCTGGTGGTTTGGCCTTGTTG CTL A2.1
    SEQ ID NO.: 10 SEQ ID NO.: 9
    Cp6 MNPNDPNRNV ATGAACCCTAATGACCCAAACAGAAACGT CTL B7
    SEQ ID NO.: 12 C
    SEQ ID NO.: 11
    C St8 MINAYLDKL ATGATCAACGCCTACTTGGACAAGTTG CTL A2.2
    SEQ ID NO.: 14 SEQ ID NO.: 13
    Ls50 ISKYEDEI ATCTCCAAGTACGAAGACGAAATC CTL B17
    SEQ ID NO.: 16 SEQ ID NO.: 15
    Pb9 SYIPSAEKI TCCTACATCCCATCTGCCGAAAAGATC CTL mouse H2-Kd
    SEQ ID NO.: 18 SEQ ID NO.: 17
    D Tr26 HLGNVKYLV CACTTGGGTAACGTTAAGTACTTGGTT CTL A2.1
    SEQ ID NO.: 20 SEQ ID NO.: 19
    Ls53 KSLYDEHI AAGTCTTTGTACGATGAACACATC CTL B58
    SEQ ID NO.: 22 SEQ ID NO.: 21
    Tr29 LLMDCSGSI TTATTGATGGACTGTTCTGGTTCTATT CTL A2.2
    SEQ ID NO.: 24 SEQ ID NO.: 23
    E NANP NANPNANPNANPN AACGCTAATCCAAACGCAAATCCGAACGC B cell
    ANP CAATCCTAACGCGAATCCC
    SEQ ID NO.: 26 SEQ ID NO.: 25
    TRAP AM DEWSPCSVTCGK GACGAATGGTCTCCATGTTCTGTCACTTGT Heparin
    GTRSRKRE GGTAAGGGTACTCGCTCTAGAAAGAGAGAA binding
    SEQ ID NO.: 28 motif
    SEQ ID NO.: 27
    F Cp39 YLNKIQNSL TACTTGAACAAAATTCAAAACTCTTTG CTL A2.1
    SEQ ID NO.: 30 SEQ ID NO.: 29
    La72 MEKLKELEK ATGGAAAAGTTGAAAGAATTGGAAAAG CTL B8
    SEQ ID NO.: 32 SEQ ID NO.: 31
    ex23 ATSVLAGL GCTACTTCTGTCTTGGCTGGTTTG CTL B58
    SEQ ID NO.: 34 SEQ ID NO.: 33
    H CSP DPNANPNVDPNANP GACCCAAACGCTAACCCAAACGTTGACCC T helper Universal
    NV AAACGCCAACCCAAACGTC epitopes
    SEQ ID NO.: 36 SEQ ID NO.: 35
    BCG QVHFQPLPPAVV CAAGTTCACTTCCAACCATTGCCTCCGGC T helper
    KL CGTTGTCAAGTTG
    SEQ ID NO.: 38 SEQ ID NO.: 37
    TT QFIKANSKFIGITE CAATTCATCAAGGCCAACTCTAAGTTCAT T helper
    SEQ ID NO.: 40 CGGTATCACCGAA
    SEQ ID NO.: 39
  • Table 1
  • Sequences included in the malaria epitope string. Each cassette consists of the epitopes shown above, in the order shown, with no additional sequence between epitopes within a cassette. A BglII site was added at the 5′ end and a BamHI site at the 3′ end, such that between cassettes in an epitope string the BamHI/BglII junction encodes GS. All epitopes are from P. falciparum antigens except for pb9 (P. berghei), BCG (M. tuberculosis) and TT (Tetanus). The amino acid and DNA sequences shown in the table have SEQ ID NOS. 1 to 40 in the order in which they appear.
  • FIG. 1 shows the construct used to express Ty-VLP with the malaria epitope cassette CABDHFE. CTL epitopes are from P. falciparum STARP (sporozoite threonine- and asparagine-rich protein) (st), LSA-1 (liver stage antigen 1) (1s), CSP (circumsporozoite protein) (cp), TRAP (thrombospondin-related adhesive protein) (tr), LSA-3 (liver stage antigen 3) (la) and Exp-1 (exported protein 1) (ex). Helper epitopes are from the P. falciparum CS protein, the M. tuberculosis 38Kd antigen and Tetanus Toxoid. NANP is the antibody epitope from CS and AM is the adhesion motif from P. falciparum TRAP (Muller et al 1993). The length of the complete string is 229 amino acids as shown in the table 1 legend, with the amino acid sequence:—MINAYLDKLISKYEDEISYIPSAEKIGSKPNDKSLYKPKDELDYKPIVQYDNFGS ASKNKEKALIIGIAGGLALLMNPNDPNRNVGSHLGNVKYLVKSLYDEHILLMD CSGSIGSDPNANPNVDPNANPNVQVHFQPLPPAVVKLQFIKANSKFIGITEGSYL NKIQNSLMEKLKELEKATSVLAGLGSNANPNANPNANPNANPDEWSPCSVTCG KGTRSRKREGSGK [SEQ ID NO: 41].
  • The HIV epitope string was also synthesised by annealing oligonucleotides. Finally the HIV and malaria epitope strings were fused by joining the BamHI site at the 3′ end of the HIV epitopes to the BglII site at the 5′ end of cassettes CAB to form the HM string (Table 2).
  • TABLE 2
    CTL Epitopes of the HIV/SIV Epitope String
    Epitope Restriction Origin
    YLKDQQLL A24, B8 HIV-1 gp4l
    (SEQ ID NO.: 42)
    ERYLKDQQL B14 HIV-1 gp4l
    (SEQ ID NO.: 43)
    EITPIGLAP Mamu-B*01 SIV env
    (SEQ ID NO.: 44)
    PPIPVGEIY B35 HIV-1 p24
    (SEQ ID NO.: 45)
    GEIYKRWII B8 HIV-1 p24
    (SEQ ID NO.: 46)
    KRWIILGLNK B*2705 HIV-1 p24
    (SEQ ID NO.: 47)
    IILGLNKIVR A33 HIV-1 p24
    (SEQ ID NO.: 48)
    LGLNKIVRMY Bw62 HIV-1 p24
    (SEQ ID NO.: 49)
    YNLTMKCR Mamu-A*02 SIV env
    (SEQ ID NO.: 50)
    RGPGRAFVTI A2, H-2Dd HIV-1 gp120
    (SEQ ID NO.: 51)
    GRAFVTIGK B*2705 HIV-1 gp120
    (SEQ ID NO.: 52)
    TPYDINQML B53 HIV-2 gag
    (SEQ ID NO.: 53)
    CTPYDINQM Mamu-A*01 SIV gag
    (SEQ ID NO.: 54)
    RPQVPLRPMTY B51 HIV-1 nef
    (SEQ ID NO.: 55)
    QVPLRPMTYK A*0301, A11 HIV-1 nef
    (SEQ ID NO.: 56)
    VPLRPMTY B35 HIV-1 nef
    (SEQ ID NO.: 57)
    AVDLSHFLK A11 HIV-1 nef
    (SEQ ID NO.: 58)
    DLSHFLKEK A*0301 HIV-1 nef
    (SEQ ID NO.: 59)
    FLKEKGGL B8 HIV-1 nef
    (SEQ ID NO.: 60)
    ILKEPVHGV A*0201 HIV-1 pol
    (SEQ ID NO.: 61)
    ILKEPVHGVY Bw62 HIV-1 pol
    (SEQ ID NO.: 62)
    HPDIVIYQY B35 HIV-1 pol
    (SEQ ID NO.: 63)
    VIYQYMDDL A*0201 HIV-1 pol
    (SEQ ID NO.: 64)
  • Table 2
  • Sequences of epitopes from HIV or SIV contained in the H epitope string and assembled as shown in FIG. 2. The amino acids in the table have SEQ ID NOS: 42 to 64 in the order in which they appear.
  • FIG. 2 shows a schematic outline of the H, M and HM proteins. The bar patterns on the schematic representations of the polyepitope proteins indicate the origin of the sequences (see tables 1 and 2). The positions of individual epitopes and their MHC restrictions are depicted above and below the proteins. Pb is the only epitope derived from the protein of P. berghei. All other epitopes in the M protein originate from proteins of P. falciparum: cs—circumsporozoite protein, st—STARP, Is—LSA-1 and tr—TRAP. BCG—38 kDa protein of M. tuberculosis; TT—tetanus toxin.
  • For the anti-tumour vaccine an epitope string containing CTL epitopes was generated, similar to the malaria and HIV epitope string. In this tumour epitope string published murine CTL epitopes were fused together to create the tumour epitope string with the amino acid sequence: MLPYLGWLVF-AQHPNAELL-KHYLFRNL-SPSYVYHQF-IPNPLLGLD [SEQ ID NO: 65]. CTL epitopes shown here were fused together. The first amino acid methionine was introduced to initiate translation.
  • Ty Virus-Like Particles (Vlps)
  • The epitope string containing cassette CABDH was introduced into a yeast expression vector to make a C-terminal in-frame fusion to the TyA protein. When TyA or TyA fusion proteins are expressed in yeast from this vector, the protein spontaneously forms virus like particles which can be purified from the cytoplasm of the yeast by sucrose gradient centrifugation. Recombinant Ty-VLPs were prepared in this manner and dialysed against PBS to remove the sucrose before injection (c.f. Layton et al. 1996).
  • Replication-defective recombinant Adenovirus with a deletion of the E1 genes was used in this study (McGrory et al, 1988). The Adenovirus expressed E. coli β-galactosidase under the control of a CMV IE promoter. For immunisations, 107 pfu of virus were administered intradermally into the ear lobe.
  • Peptides were purchased from Research Genetics (USA), dissolved at 10 mg/ml in DMSO (Sigma) and further diluted in PBS to 1 mg/ml. Peptides comprising CTL epitopes that were used in the experiments described herein are listed in table 3.
  • TABLE 3
    Sequence of CTL Peptide Epitopes
    MHC
    sequence Antigen restriction
    LPYLGWLVF P1A tumour Ld
    (SEQ ID NO.: 66) antigen
    SYIPSAEKI P. berghei CSP Kd
    (SEQ ID NO.: 67)
    RGPGRAFVTI HIV gag Dd
    (SEQ ID NO.: 68)
    TPHPARIGL E. coli Ld
    (SEQ ID NO.: 69) b-galactosidase
    TYQRTRALV Influenza A virus NP Kd
    (SEQ ID NO.: 70)
    SDYEGRLI Influenza A virus NP Kk
    (SEQ ID NO.: 71)
    ASNENMETM Influenza A virus NP Db
    (SEQ ID NO.: 72)
    INVAFNRFL P. falciparum TRAP Kb
    (SEQ ID NO.: 73)
  • The amino acid sequences in Table 3 have SEQ ID NOS: 66 to 73, in the order in which they appear in the Table.
  • Plasmid DNA Constructs
  • A number of different vectors were used for constructing DNA vaccines. Plasmid pTH contains the CMV IE promoter with intron A, followed by a polylinker to allow the introduction of antigen coding sequences and the bovine growth hormone transcription termination sequence. The plasmid carries the ampicillin resistance gene and is capable of replication in E. coli but not mammalian cells. This was used to make DNA vaccines expressing each of the following antigens: P. berghei TRAP, P. berghei CS, P. falciparum TRAP, P. falciparum LSA-1 (278 amino acids of the C terminus only), the epitope string containing cassettes CABDH and the HM epitope string (HIV epitopes followed by cassettes CAB). Plasmid pSG2 is similar to pTH except for the antibiotic resistance gene. In pSG2 the ampicillin resistance gene of pTH has been replaced by a kanamycin resistance gene. pSG2 was used to make DNA vaccines expressing the following antigens: P. berghei PbCSP, a mouse tumour epitope string, the epitope string containing cassettes CABDH and the HM epitope string. Plasmid V1J-NP expresses influenza nucleoprotein under the control of a CMV IE promoter. Plasmids CMV-TRAP and CMV-LSA-1 are similar to pTH.TRAP and pTH. LSA-1 but do not contain intron A of the CMV promoter. Plasmids RSV.TRAP and RSV.LSA-1 contain the RSV promoter, SV40 transcription termination sequence and are tetracycline resistant. For induction of β-galactosidase-specific CTL plasmid pcDNA3/His/LacZ (Invitrogen) was used. All DNA vaccines were prepared from E. coli strain DH5α using Qiagen plasmid purification columns.
  • Generation of Recombinant Vaccinia Viruses
  • Recombinant MVAs were made by first cloning the antigen sequence into a shuttle vector with a viral promoter such as the plasmid pSC11 (Chakrabarti et al. 1985; Morrison et al. 1989). P. berghei CS and P. falciparum TRAP, influenza nucleoprotein and the HM and mouse tumour epitope polyepitope string were each expressed using the P7.5 promoter (Mackett et al. 1984), and P. berghei TRAP was expressed using the strong synthetic promoter (SSP; Carroll et al. 1995). The shuttle vectors, pSC11 or pMCO3 were then used to transform cells infected with wild-type MVA so that viral sequences flanking the promoter, antigen coding sequence and marker gene could recombine with the MVA and produce recombinants. Recombinant viruses express the marker gene (β glucuronidase or β galactosidase) allowing identification of plaques containing recombinant virus. Recombinants were repeatedly plaque purified before use in immunisations. The recombinant NYVAC-PbCSP vaccinia was previously described (Lanar et al. 1996). The wild type or Western Reserve (WR) strain of recombinant vaccinia encoding PbCSP was described previously (Satchidanandam et al. 1991).
  • Cells and Culture Medium
  • Murine cells and Epstein-Barr virus transformed chimpanzee and macaque B cells (BCL) were cultured in RPMI supplemented with 10% heat inactivated fetal calf serum (FCS). Splenocytes were restimulated with the peptides indicated (final concentration 1 μg/ml) in MEM medium with 10% FCS, 2 mM glutamine, 50 U/ml penicillin, 50 μM 2-mercaptoethanol and 10 mM Hepes pH7.2 (Gibco, UK).
  • Animals
  • Mice of the strains indicated, 6-8 weeks old were purchased from Harlan Olac (Shaws Farm, Blackthorn, UK). Chimpanzees H1 and H2 were studied at the Biomedical Primate Research Centre at Rijswick, The Netherlands. Macaques were studied at the University of Oxford.
  • Immunisations
  • Plasmid DNA immunisations of mice were performed by intramuscular immunisation of the DNA into the musculus tibialis under anaesthesia. Mouse muscle was sometimes pre-treated with 50 μl of 1 mM cardiotoxin (Latoxan, France) 5-9 days prior to immunisation as described by Davis et al (1993), but the presence or absence of such pre-treatment was not found to have any significant effect on immunogenicity or protective efficacy. MVA immunisation of mice was performed by either intramuscular (i.m.), intravenous (into the lateral tail vein) (i.v.), intradermal (i.d.), intraperitoneal (i.p.) or subcutaneous (s.c.) immunisation. Plasmid DNA and MVA immunisation of the chimpanzees H1 and H2 was performed under anaesthesia by intramuscular immunisation of leg muscles. For these chimpanzee immunisations the plasmid DNA was co-administered with 15 micrograms of human GM-CSF as an adjuvant. Recombinant MVA administration to the chimpanzees was by intramuscular immunisation under veterinary supervision. Recombinant human GM-CSF was purchased from Sandoz (Camberley, UK). For plasmid DNA immunisations using a gene gun, DNA was precipitated onto gold particles. For intradermal delivery, two different types of gene guns were used, the Acell and the Oxford Bioscience device (PowderJect Pharmaceuticals, Oxford, UK).
  • Elispot Assays
  • CD8+ T cells were quantified in the spleens of immunised mice without in vitro restimulation using the peptide epitopes indicated and the ELISPOT assay as described by Miyahara et at (1993). Briefly, 96-well nitrocellulose plates (Miliscreen MAHA, Millipore, Bedford UK) were coated with 15 μg/ml of the anti-mouse interferon-γ monoclonal antibody R4 (EACC) in 50 μl of phosphate-buffered saline (PBS). After overnight incubation at 4° C. the wells were washed once with PBS and blocked for 1 hour at room temperature with 100 μl RPMI with 10% FCS. Splenocytes from immunised mice were resuspended to 1×107 cells/ml and placed in duplicate in the antibody coated wells and serially diluted. Peptide was added to each well to a final concentration of 1 μg/ml. Additional wells without peptide were used as a control for peptide-dependence of interferon-γ secretion. After incubation at 37° C. in 5% CO2 for 12-18 hours the plates were washed 6 times with PBS and water. The wells were then incubated for 3 hours at room temperature with a solution of 1 μg/ml of biotinylated anti-mouse interferon-γ monoclonal antibody XMG1.2 (Pharmingen, CA, USA) in PBS. After further washes with PBS, 50 μl of a 1 μg/ml solution of streptavidin-alkaline-phosphatase polymer (Sigma) was added for 2 hours at room temperature. The spots were developed by adding 50 μl of an alkaline phosphatase conjugate substrate solution (Biorad, Hercules, Calif., USA). After the appearance of spots the reaction was stopped by washing with water. The number of spots was determined with the aid of a stereomicroscope.
  • ELISPOT assays on the chimpanzee peripheral blood lymphocytes were performed using a very similar method employing the assay and reagents developed to detect human CD8 T cells (Mabtech, Stockholm).
  • CTL Assays
  • CTL assays were performed using chromium labelled target cells as indicated and cultured mouse spleen cells as effector cells as described by Allsopp et al. (1996). CTL assays using chimpanzee or macaque cells were performed as described for the detection of human CTL by Hill et al. (1992) using EBV-transformed autologous chimpanzee or macaque B cell lines as target cells.
  • P. Berghei Challenge
  • Mice were challenged with 2000 (BALB/c) or 200 (C57BL/6) sporozoites of the P. berghei ANKA strain in 200 ml RPMI by intravenous inoculation as described (Lanar et al. 1996). These sporozoites were dissected from the salivary glands of Anopheles stephensi mosquitoes maintained at 18° C. for 20-25 days after feeding on infected mice. Blood-stage malaria infection, indicating a failure of the immunisation, was detected by observing the appearance of ring forms of P. berghei in Giemsa-stained blood smears taken at 5-12 days post-challenge.
  • P. Falciparum Challenge
  • The chimpanzees were challenged with 20,000 P. falciparum sporozoites of the NF54 strain dissected from the salivary glands of Anopheles gambiae mosquitoes, by intravenous inoculation under anaesthesia. Blood samples from these chimpanzees were examined daily from day 5 after challenge by microscopy and parasite culture, in order to detect the appearance of low levels of P. falciparum parasites in the peripheral blood.
  • Mice were challenged with 1×105 P815 cells in 200 μl of PBS by intravenous inoculation. Animals were monitored for survival.
  • Influenza Virus Challenges
  • Mice were challenged with 100 haemagglutinating units (HA) of influenza virus A/PR/8/34 by intranasal inoculation. Following challenge the animals were weighed daily and monitored for survival.
  • Determining Peptide Specific CTL Using Tetramers
  • Tetrameric complexes consisting of Mamu-A*01-heavy chain and β2-microglobulin were made as described by Ogg et al (1998). DNA coding for the leaderless extracellular portion of the Mamu-A*01 MHC class I heavy chain was PCR-amplified from cDNA using 5′ primer MamuNdeI: 5′-CCT GAC TCA GAC CAT ATG GGC TCT CAC TCC ATG [SEQ ID NO: 74] and 3′ primer: 5′-GTG ATA AGC TTA ACG ATG ATT CCA CAC CAT TTT CTG TGC ATC CAG AAT ATG ATG CAG GGA TCC CTC CCA TCT CAG GGT GAG GGG C [SEQ ID NO: 75]. The former primer contained a NdeI restriction site, the latter included a HindIII site and encoded for the bioinylation enzyme BirA substrate peptide. PCR products were digested with NdeI and HindIII and ligated into the same sites of the polylinker of bacterial expression vector pGMT7. The rhesus monkey gene encoding a leaderless β2-microglobulin was PCR amplified from a cDNA clone using primers B2 MBACK: 5′-TCA GAC CAT ATG TCT CGC TCC GTG GCC [SEQ ID NO: 76] and B2MFOR: 5′-TCA GAC AAG CTT TTA CAT GTC TCG ATC CCA C [SEQ ID NO: 77] and likewise cloned into the NdeI and HindIII sites of pGMT7. Both chains were expressed in E. coli strain BL-21, purified from inclusion bodies, refolded in the presence of peptide CTPYDINQM [SEQ ID NO: 54], biotinylated using the BirA enzyme (Avidity) and purified with FPLC and monoQ ion exchange columns. The amount of biotinylated refolded MHC-peptide complexes was estimated in an ELISA assay, whereby monomeric complexes were first captured by conformation sensitive monoclonal antibody W6/32 and detected by alkaline phosphatase (AP)—conjugated streptavidin (Sigma) followed by colorimetric substrate for AP. The formation of tetrameric complexes was induced by addition of phycoerythrin (PE)-conjugated streptavidin (ExtrAvidin; Sigma) to the refolded biotinylated monomers at a molar ratio of MHC-peptide:PE-streptavidin of 4:1. The complexes were stored in the dark at 4° C. These tetramers were used to analyse the frequency of Mamu-A*01/gag-specific CD8+ T cells in peripheral blood lymphocytes (PBL) of immunised macaques.
  • Example 2
  • Previous studies of the induction of CTL against epitopes in the circumsporozoite (CS) protein of Plasmodium berghei and Plasmodium yoelii have shown variable levels of CTL induction with different delivery systems. Partial protection has been reported with plasmid DNA (Sedegah et al. 1994), influenza virus boosted by replicating vaccinia virus (Li et al. 1991), adenovirus (Rodrigues et al 1997) and particle delivery systems (Schodel et al. 1994). Immunisation of mice intramuscularly with 50 micrograms of a plasmid encoding the CS protein produced moderate levels of CD8+ cells and CTL activity in the spleens of these mice after a single injection (FIGS. 3, 4A-4D).
  • For comparison groups of BALB/c mice (n=5) were injected intravenously with 106 ffu/pfu of recombinant vaccinia viruses of different strains (WR, NYVAC and MVA) all expressing P. berghei CSP. The frequencies of peptide-specific CD8+ T cells were measured 10 days later in an ELISPOT assay. MVA.PbCSP induced 181+/−48, NYVAC 221+/−27 and WR 94+/−19 (mean+/−standard deviation) peptide-specific CD8+ T cells per million splenocytes. These results show that surprisingly replication-impaired vaccinia viruses are superior to replicating strains in priming a CD8+ T cell response. We then attempted to boost these moderate CD8+ T cell responses induced by priming with either plasmid DNA or MVA using homologous or heterologous vectors. A low level of CD8+ T cells was observed after two immunisations with CS recombinant DNA vaccine alone, the recombinant MVA vaccine alone or the recombinant MVA followed by recombinant DNA (FIG. 3). A very much higher level of CD8+ T cells was observed by boosting the DNA-primed immune response with recombinant MVA. In a second experiment using ten mice per group the enhanced immunogenicity of the DNA/MVA sequence was confirmed: DNA/MVA 856+/−201; MVA/DNA 168+/−72; MVA/MVA 345+/−90; DNA/DNA 92+/−46. Therefore the sequence of a first immunisation with a recombinant plasmid encoding the CS protein followed by a second immunisation with the recombinant MVA virus yielded the highest levels of CD8+ T lymphocyte response after immunisation.
  • FIG. 3 shows malaria CD8 T cell ELISPOT data following different immunisation regimes. Results are shown as the number of peptide-specific T cells per million splenocytes. Mice were immunised either with the PbCSP-plasmid DNA or the PbCSP-MVA virus or combinations of the two as shown on the X axis, at two week intervals and the number of splenocytes specific for the pb9 malaria epitope assayed two weeks after the last immunisation. Each point represents the number of spot-forming cells (SFCs) measured in an individual mouse. The highest level of CD8+ T cells was induced by priming with the plasmid DNA and boosting with the recombinant MVA virus. This was more immunogenic than the reverse order of immunisation (MVA/DNA), two DNA immunisations (DNA/DNA) or two MVA immunisations (MVA/MVA). It was also more immunogenic than the DNA and MVA immunisations given simultaneously (DNA+MVA 2w), than one DNA immunisation (DNA 4w) or one MVA immunisation given at the earlier or later time point (MVA 2w and MVA 4w).
  • FIGS. 4A-4D shows that malaria CD8 T cell ELISPOT and CTL levels are substantially boosted by a recombinant MVA immunisation following priming with a plasmid DNA encoding the same antigen. A AND C. CD8+ T cell responses were measured in BALB/c mice using the g-interferon ELISPOT assay on fresh splenocytes incubated for 18 h with the Kd restricted peptide SYIPSAEKI [SEQ ID NO: 67] from P. berghei CSP and the Ld restricted peptide TPHPARIGL [SEQ ID NO: 69] from E. coli β-galactosidase. Note that the ELISPOT counts are presented on a logarithmic scale. B and D. Splenocytes from the same mice were also assayed in conventional 51Cr-release assays at an effector: target ration of 100:1 after 6 days of in vitro restimulation with the same peptides (1 μg/ml).
  • The mice were immunised with plasmid DNA expressing either P. berghei CSP and TRAP, PbCSP alone, the malaria epitope cassette including the P. berghei CTL epitope (labelled pTH.M), or β-galactosidase. ELISPOT and CTL levels measured in mice 23 days after one DNA immunisation are shown in A and B respectively. The same assays were performed with animals that received additionally 1×107 ffu of recombinant MVA expressing the same antigen(s) two weeks after the primary immunisation. The ELISPOT and CTL levels in these animals are shown in C and D respectively. Each bar represents data from an individual animal.
  • Studies were also undertaken of the immunogenicity of the epitope string HM comprising both HIV and malaria epitopes in tandem. Using this epitope string again the highest levels of CD8+ T cells and CTL were generated in the spleen when using an immunisation with DNA vaccine followed by an immunisation with a recombinant MVA vaccine (Table 4, FIG. 5).
  • TABLE 4
    Immunogenicity of Various DNA/MVA Combinations
    as Determined by Elispot Assays
    Immunisation
    1 Immunisation 2 HIV epitope Malaria epitope
    DNA-HM DNA-HM 56 ± 26 4 ± 4
    MVA-HM MVA-HM 786 ± 334 238 ± 106
    MVA-HM DNA-HM 306 ± 78  58 ± 18
    DNA-HM MVA-HM 1000 ± 487  748 ± 446
    None DNA-HM 70 ± 60 100 ± 10 
    None MVA-HM 422 ± 128 212 ± 94 
  • Table 4 shows the results of ELISPOT assays performed to measure the levels of specific CD8+ T cells to HIV and malaria epitopes following different immunisation regimes of plasmid DNA and MVA as indicated. The numbers are spot-forming cells per million splenocytes. The HM epitope string is illustrated in FIG. 2. BALB/c mice were used in all cases. The malaria epitope was pb9 as in FIGS. 2 and 3. The HIV epitope was RGPGRAFVTI [SEQ ID NO: 51]. The immunisation doses were 50 μg of plasmid DNA or 107 focus-forming units (ffu) of recombinant MVA. All immunisations were intramuscular. The interval between immunisations 1 and 2 was from 14-21 days in all cases.
  • FIG. 5 shows the CTL responses induced in BALB/c mice to malaria and HIV epitopes by various immunisation regimes employing plasmid DNA and recombinant MVA. Mice were immunised intramuscularly as described in the legend to table 3 and in methods. High levels of CTL (>30% specific lysis at effector/target ration of 25:1) were observed to both the malaria and HIV epitopes only after priming with plasmid DNA and boosting with the recombinant MVA. The antigen used in this experiment is the HIV-malaria epitope string. The recombinant MVA is denoted MVA.HM and the plasmid DNA expressing this epitope string is denoted pTH.HM. Levels of specific lysis at various effector to target ratios are shown. These were determined after 5 days in vitro restimulation of splenocytes with the two peptides pb9 and RGPGRAFVTI [SEQ ID NO: 51].
  • Comparison of numerous delivery systems for the induction of CTL was reported by Allsopp et al. (1996). Recombinant Ty-virus like particles (Ty-VLPs) and lipid-tailed malaria peptides both gave good CTL induction but Ty-VLPs were better in that they required only a single immunising dose for good CTL induction. However, as shown here even two doses of Ty particles fail to induce significant protection against sporozoite challenge (Table 7, line 1). Immunisation with a recombinant modified vaccinia Ankara virus encoding the circumsporozoite protein of P. berghei also generates good levels of CTL. However, a much higher level of CD8+ T cell response is achieved by a first immunisation with the Ty-VLP followed by a second immunisation with the MVA CS vaccine (Table 5).
  • TABLE 5
    Immunogenicity of Various Ty-VLP/MVA Combinations
    as Determined by ELISPOT and CTL Assays
    Immunisation
    1 Immunisation 2 ELISPOT No % Specific Lysis
    Ty-CABDH Ty- CABDH 75 15
    MVA.PbCSP MVA.PbCSP 38 35
    Ty-CABDH MVA.PbCSP 225 42
    Ty- CABDH MVA.HM 1930 nd

    Table 5 Results of ELISPOT and CTL assays performed to measure the levels of specific CD8+ T cells to the malaria epitope pb9 following different immunisation regimes of Ty-VLPs and recombinant MVA virus as indicated. The CTL and ELISPOT data are from different experiments. The ELISPOT levels (spots per million splenocytes) are measured on un-restimulated cells and the CTL activity, indicated as specific lysis at an effector to target ratio of 40:1, on cells restimulated with pb9 peptide in vitro for 5-7 days. Both represent mean levels of three mice. BALB/c mice were used in all cases. The immunisation doses were 50 μg of Ty-VLP or 107 ffu (foci forming units) of recombinant MVA. All immunisations were intramuscular. The interval between immunisations 1 and 2 was from 14-21 days. MVA.HM includes cassettes CAB.
    Priming of an Immune Response with DNA Delivered by a Gene Gun and Boosting with Recombinant MVA
  • Immunogenicity and Challenge
  • The use of a gene gun to deliver plasmid DNA intradermally and thereby prime an immune response that could be boosted with recombinant MVA was investigated. Groups of BALB/c mice were immunised with the following regimen:
      • I) Three gene gun immunisations with pTH.PbCSP (4 mg per immunisation) at two week intervals
      • II) Two gene gun immunisations followed by MVA i.v. two weeks later
      • III) One intramuscular DNA immunisation followed by MVA i.v. two weeks later.
  • The immunogenicity of the three immunisation regimens was analysed using ELISPOT assays. The highest frequency of specific T cells was observed with two gene gun immunisations followed by an MVA i.v. boost and the intramuscular DNA injection followed an MVA i.v. boost (FIG. 6).
  • FIG. 6 shows the results of ELISPOT assays performed to measure the levels of specific CD8+ T cells to the malaria epitope pb9 following different immunisation regimes. Groups of BALB/c mice (n=3) were immunised as indicated (g.g.=gene gun). The time between all immunisations was 14 days. ELISPOT assays were done two weeks after the last immunisation.
  • CTL Induction to the Same Antigen in Different Mouse Strains
  • To address the question whether the boosting effect described above in BALB/c mice with two CTL epitopes SYIPSAEKI [SEQ ID NO: 67] derived from P. berghei CSP and RGPGRAFVTI [SEQ ID NO: 68] derived from HIV is a universal phenomenon, two sets of experiments were carried out. CTL responses to the influenza nucleoprotein were studied in five inbred mouse strains. In a first experiment three published murine CTL epitopes derived from the influenza nucleoprotein were studied (see Table 3). Mice of three different H-2 haplotypes, BALB/c and DBA/2 (H-2d), C57BL/6 and 129 (H-2b); CBA/J (H-2k), were used. One set of animals was immunised twice at two week intervals with the plasmid V1J-NP encoding the influenza nucleoprotein. Another set of identical animals was primed with V1J-NP and two weeks later boosted intravenously with 106 ffu of MVA.NP, expressing influenza virus NP. The levels of CTL in individual mice were determined in a 51Cr-release assay with peptide re-stimulated splenocytes. As shown in FIG. 7, the DNA priming/MVA boosting immunisation regimen induced higher levels of lysis in all the mouse strains analysed and is superior to two DNA injections.
  • FIG. 7 shows the CTL responses against influenza NP in different mouse strains. Mice of different strains were immunised twice two weeks apart with a DNA vaccine V1J-NP encoding for the influenza nucleoprotein (open circles) or primed with the same DNA vaccine and two weeks later boosted with recombinant MVA expressing influenza virus nucleoprotein (closed circles). Two weeks after the last immunisation splenocytes were restimulated in vitro with the respective peptides (Table 3). The CTL activity was determined in a standard 51Cr-release assay with MHC class I-matched target cells.
  • CTL Induction to Different Antigens in Different Mouse Strains
  • The effect of MVA boosting on plasmid DNA-primed immune responses was further investigated using different antigens and different inbred mouse strains. Mice of different strains were immunised with different antigens using two DNA immunisations and compared with DNA/MVA immunisations. The antigens used were E. coli β-galactosidase, the malaria/HIV epitope string, a murine tumour epitope string and P. falciparum TRAP. Compared with two DNA immunisations the DNA-priming/MVA-boosting regimen induced higher levels of CTL in all the different mouse strains and antigen combinations tested (FIGS. 8A-8H).
  • FIGS. 8A-8H show CTL responses against different antigens induced in different inbred mouse strains. Mice were immunised with two DNA vaccine immunisations two weeks apart (open circles) or primed with a DNA vaccine and two weeks later boosted with a recombinant MVA expressing the same antigen (closed circles). The strains and antigens were: C57BL/6; P. falciparum TRAP in A. DBA/2; E. coli b-galactosidase in B. BALB/c; HM epitope string CTL activity against malaria peptide (pb9) in C. DBA/2; HM epitope string CTL activity against pb9 in D. BALB/c; HM epitope string CTL activity against HIV peptide in E. DBA/2; HM epitope string CTL activity against HIV peptide in F. BALB/c; tumour epitope string CTL activity against P1A-derived peptide in G. DBA/2; tumour epitope string CTL activity against P1A-derived peptide in H. Sequences of peptide epitopes are shown in table 3. Each curve shows the data for an individual mouse.
  • Sporozoites can Efficiently Prime an Immune Response that is Boostable by MVA
  • Humans living in malaria endemic areas are continuously exposed to sporozoite inoculations. Malaria-specific CTL are found in these naturally exposed individuals at low levels. To address the question whether low levels of sporozoite induced CTL responses can be boosted by MVA, BALB/c mice were immunised with irradiated (to prevent malaria infection) P. berghei sporozoites and boosted with MVA. Two weeks after the last immunisation splenocytes were re-stimulated and tested for lytic activity. Two injections with 50 or 300+500 sporozoites induced very low or undetectable levels of lysis. Boosting with MVA induced high levels of peptide specific CTL. MVA alone induced only moderate levels of lysis (FIGS. 9A-9E).
  • FIGS. 9A-9E show sporozoite-primed CTL responses are substantially boosted by MVA. Mice were immunised with two low doses (50+50) of irradiated sporozoites in FIG. 9A; two high doses (300+500) of sporozoites in FIG. 9B; mice were boosted with MVA.PbCSP following low-dose sporozoite priming in FIG. 9D; high dose sporozoite priming in FIG. 9E. CTL responses following immunisation with MVA.PbCSP are shown in FIG. 9C.
  • Recombinant Adenoviruses as Priming Agent
  • The prime-boost immunisation regimen has been exemplified using plasmid DNA and recombinant Ty-VLP as priming agent. Here an example using non-replicating adenoviruses as the priming agent is provided. Replication-deficient recombinant Adenovirus expressing E. coli β-galactosidase (Adeno-GAL) was used. Groups of BALB/c mice were immunised with plasmid DNA followed by MVA or with Adenovirus followed by MVA. All antigen delivery systems used encoded E. coli β-galactosidase. Priming a CTL response with plasmid DNA or Adenovirus and boosting with MVA induces similar levels of CTL (FIGS. 10A-10B).
  • FIGS. 10A-10B show CTL responses primed by plasmid DNA or recombinant Adenovirus and boosted with MVA. Groups of BALB/c mice (n=3) were primed with plasmid DNA (FIG. 10A); or recombinant Adenovirus expressing β-galactosidase (FIG. 10B). Plasmid DNA was administered intramuscularly, MVA intravenously and Adenovirus intradermally. Splenocytes were restimulated with peptide TPHPARIGL [SEQ ID NO: 69] two weeks after the last immunisation. CTL activity was tested with peptide-pulsed P815 cells.
  • Immunogenicity of the DNA Prime Vaccinia Boost Regimen Depends on the Replication Competence of the Strain of Vaccinia Virus Used
  • The prime boosting strategy was tested using different strains of recombinant vaccina viruses to determine whether the different strains with strains differing in their replication competence may differ in their ability to boost a DNA-primed CTL response. Boosting with replication-defective recombinant vaccinia viruses such as MVA and NYVAC resulted in the induction of stronger CTL responses compared to CTL responses following boosting with the same dose of replication competent WR vaccinia virus (FIGS. 11A-11C).
  • FIGS. 11A-11C show CTL responses in BALB/c mice primed with plasmid DNA followed by boosting with different recombinant vaccinia viruses. Animals were primed with pTH.PbCSP 50 μg/mouse i.m. and two weeks later boosted with different strains of recombinant vaccina viruses (106 pfu per mouse i.v.) expressing PbCSP. The different recombinant vaccinia virus strains were MVA in FIG. 11A; NYVAC in FIG. 11B and WR in FIG. 11C. The superiority of replication-impaired vaccinia strains over replicating strains was found in a further experiment. Groups of BALB/c mice (n=6) were primed with 50 μg/animal of pSG2.PbCSP (i.m.) and 10 days later boosted i.v. with 106 ffu/pfu of recombinant MVA, NYVAC and WR expressing PbCSP. The frequencies of peptide-specific CD8+ T cells were determined using the ELISPOT assay. The frequencies were: MVA 1103+/−438, NYVAC 826+/−249 and WR 468+/−135. Thus using both CTL assays and ELISPOT assays as a measure of CD8 T cell immunogenicity a surprising substantially greater immunogenicity of the replication-impaired vaccinia strains was observed compared to the replication competent strain.
  • The Use of Recombinant Canary or Fowl Pox Viruses for Boosting Cd8+ T Cell Responses
  • Recombinant canary pox virus (rCPV) or fowl pox virus (rFVP) are made using shuttle vectors described previously (Taylor et al. Virology 1992, 187: 321-328 and Taylor et al. Vaccine 1988, 6: 504-508). The strategy for these shuttle vectors is to insert the gene encoding the protein of interest preceded by a vaccinia-specific promoter between two flanking regions comprised of sequences derived from the CPV or FPV genome. These flanking sequences are chosen to avoid insertion into essential viral genes. Recombinant CPV or FPV are generated by in vivo recombination in permissive avian cell lines i.e. primary chicken embryo fibroblasts. Any protein sequence of antigens or epitope strings can be expressed using fowl pox or canary pox virus. Recombinant CPV or FPV is characterised for expression of the protein of interest using antigen-specific antibodies or including an antibody epitope into the recombinant gene. Recombinant viruses are grown on primary CEF. An immune response is primed using plasmid DNA as described in Materials and Methods. This plasmid DNA primed immune response is boosted using 107 ffu/pfu of rCPV or rFPV inoculated intravenously, intradermally or intramuscularly. CD8+ T cell responses are monitored and challenges are performed as described herein.
  • Example 3 Malaria Challenge Studies in Mice
  • To assess the protective efficacy of the induced levels of CD8+ T cell response immunised BALB/c or C57BL/6 mice were challenged by intravenous injection with 2000 or 200 P. berghei sporozoites. This leads to infection of liver cells by the sporozoites. However, in the presence of a sufficiently strong T lymphocyte response against the intrahepatic parasite no viable parasite will leave the liver and no blood-stage parasites will be detectable. Blood films from challenged mice were therefore assessed for parasites by microscopy 5-12 days following challenge.
  • BALB/c mice immunised twice with a mixture of two plasmid DNAs encoding the CS protein and the TRAP antigen, respectively, of P. berghei were not protected against sporozoite challenge. Mice immunised twice with a mixture of recombinant MVA viruses encoding the same two antigens were not protected against sporozoite challenge. Mice immunised first with the two recombinant MVAs and secondly with the two recombinant plasmids were also not protected against sporozoite challenge. However, all 15 mice immunised first with the two plasmid DNAs and secondly with the two recombinant MVA viruses were completely resistant to sporozoite challenge (Table 6 A and B).
  • To assess whether the observed protection was due to an immune response to the CS antigen or to TRAP or to both, groups of mice were then immunised with each antigen separately (Table 6 B). All 10 mice immunised first with the CS plasmid DNA and secondly with the CS MVA virus were completely protected against sporozoite challenge. Fourteen out of 16 mice immunised first with the TRAP plasmid DNA vaccine and secondly with the TRAP MVA virus were protected against sporozoite challenge. Therefore the CS antigen alone is fully protective when the above immunisation regime is employed and the TRAP antigen is substantially protective with the same regime.
  • The good correlation between the induced level of CD8+ T lymphocyte response and the degree of protection observed strongly suggests that the CD8+ response is responsible for the observed protection. In previous adoptive transfer experiments it has been demonstrated that CD8+ T lymphocyte clones against the major CD8+ T cell epitope in the P. berghei CS protein can protect against sporozoite challenge. To determine whether the induced protection was indeed mediated by CD8+ T cells to this epitope we then employed a plasmid DNA and a recombinant MVA encoding only this nine amino acid sequence from P. berghei as a part of a string of epitopes (Table 6 B). (All the other epitopes were from micro-organisms other than P. berghei). Immunisation of 10 mice first with a plasmid encoding such an epitope string and secondly with a recombinant MVA also encoding an epitope string with the P. berghei CTL epitope led to complete protection from sporozoite challenge (Table 6 B). Hence the induced protective immune response must be the CTL response that targets this nonamer peptide sequence.
  • TABLE 6
    Results of Mouse Challenge Experiments Using
    Different Combinations of DNA and MVA Vaccine
    No. Infected/ % Pro-
    Immunisation 1 Immunisation 2 No. challenged tection
    A. Antigens used: PbCSP + PbTRAP
    DNA DNA
    5/5 0%
    MVA MVA  9/10 10%
    DNA MVA
    0/5 100%
    MVA DNA
    5/5 0%
    Control mice immunised with ÿ- galactosidase
    DNA DNA
    5/5 0%
    MVA MVA
    5/5 0%
    DNA MVA
    5/5 0%
    MVA DNA
    5/5 0%
    B.
    DNA (CSP + TRAP) MVA (CSP + TRAP)  0/10 100%
    DNA (CSP) MVA (CSP)  0/10 100%
    DNA (TRAP) MVA (TRAP)  2/16 88%
    DNA (epitope) MVA (epitope)  0/11 100%
    DNA (beta-gal) MVA (beta-gal) 6/7 14%
    none none  9/10 10%

    Table 6 Results of Two Challenge Experiments (A and B) Using Different Immunisation regimes of plasmid DNA and MVA as indicated. BALB/c mice were used in all cases. The immunisation doses were 50 μg of plasmid DNA or 106 ffu of recombinant MVA. The interval between immunisations 1 and 2 was from 14-21 days in all cases. Challenges were performed at 18-29 days after the last immunisation by i.v. injection of 2000 P. berghei sporozoites and blood films assessed at 5, 8 and 10 days post challenge. CSP and TRAP indicate the entire P. berghei antigen and ‘ epitope’ indicates the cassettes of epitopes shown in table 1 containing only a single P. berghei K d− restricted nonamer CTL epitope. Note that in experiment B immunisation with the epitope string alone yields 100% protection.
  • Mice immunised twice with recombinant Ty-VLPs encoding pb9 were fully susceptible to infection. Similarly mice immunised twice with the recombinant MVA encoding the full CS protein were fully susceptible to infection. However, the mice immunised once with the Ty-VLP and subsequently once with the recombinant MVA showed an 85% reduction in malaria incidence when boosted with MVA expressing the full length CS protein, and 95% when MVA expressing the HM epitope string which includes pb9 was used to boost (Table 7).
  • TABLE 7
    Results of Challenge Experiments Using Different
    Immunisation Regimes of Ty-VLPs and MVA
    No. Infected/ % Pro-
    Immunisation 1 Immunisation 2 No. challenged tection
    Ty-CABDHFE Ty- CABDHFE 7/8 13%
    Ty-CABDH MVA.PbCSP  2/13 85%
    Ty- CABDHFE MVA-NP 5/5 0%
    MVA.PbCSP MVA.PbCSP 6/6 0%
    MVA.HM Ty- CABDHFE 14/14 0%
    Ty- CABDHFE MVA.HM  1/21 95%
    none MVA.HM 8/8 0%
    none none 11/12 9%

    Table 7 Results of Challenge Experiments Using Different Immunisation Regimes of Ty-VLPs and MVA as Indicated. BALb/c Mice Were Used in All Cases. Immunisations were of 50 μg of Ty-VLP or 107 ffu of recombinant MVA administered intravenously. The interval between immunisations 1 and 2 was from 14-21 days in all cases. Challenges were performed at 18-29 days after the last immunisation by i.v. injection of 2000 P. berghei sporozoites and blood films assessed at 5, 8 and 10 days post challenge. CSP indicates the entire P. berghei antigen. Ty-VLPs carried epitope cassettes CABDH or CABDHFE as described in table 1. MVA.HM includes cassettes CAB.
  • To determine whether the enhanced immunogenicity and protective efficacy observed by boosting with a recombinant MVA is unique to this particular vaccinia virus strain or is shared by other recombinant vaccinias the following experiment was performed. Mice were immunised with the DNA vaccine encoding P. berghei CS protein and boosted with either (i) recombinant MVA encoding this antigen; (ii) recombinant wild-type vaccinia virus (Western Reserve strain) encoding the same antigen (Satchidanandam et al. 1991), or (iii) recombinant NYVAC(COPAK) virus (Lanar et al. 1996) encoding the same malaria antigen. The highest degree of protection was observed with boosting by the MVA recombinant, 80% (Table 8). A very low level of protection (10%) was observed by boosting with the wild-type recombinant vaccinia virus and a significant level of protection, 60%, by boosting with the NYVAC recombinant. Hence the prime-boost regime we describe induces protective efficacy with any non-replicating vaccinia virus strain. Both the MVA recombinant and NYVAC were significantly (P<0.05 for each) better than the WR strain recombinant.
  • TABLE 8
    Challenge Data Results for DNA Boosted with
    Various Vaccinia Strain Recombinants.
    No. Infected/ % Pro-
    Immunisation 1 Immunisation 2 No. challenged tection
    DNA-beta gal. MVA.NP 8/8   0%
    DNA-CSP MVA-CSP 2/10 80%
    DNA-CSP WR-CSP 9/10 10%
    DNA-CSP NYVAC-CSP 4/10 60%
  • Table 8 Results of a challenge experiment using different immunisation regimes of plasmid DNA and various vaccinia recombinants as indicated. BALB/c mice were used in all cases. The immunisation doses were 50 μg of plasmid DNA or 106 ffu/pfu of recombinant MVA or 104 ffu/pfu of recombinant wild type (WR) vaccinia or 106 ffu/pfu of recombinant NYVAC. Because the WR strain will replicate in the host and the other strains will not, in this experiment a lower dose of WR was used. The interval between immunisations 1 and 2 was 23 days. Challenges were performed at 28 days after the last immunisation by i.v. injection of 2000 P. berghei sporozoites and blood films assessed at 7, 9 and 11 days post challenge. pbCSP indicates the entire P. berghei antigen and NP the nucleoprotein antigen of influenza virus (used as a control antigen). The first immunisation of group A mice was with the plasmid DNA vector expressing beta galactosidase but no malaria antigen.
  • In a further experiment shown in Table 8, mice were immunised with the DNA vaccine encoding P. berghei CS protein and boosted with either (i) recombinant MVA encoding this antigen; (ii) recombinant WR vaccinia virus encoding the same antigen or (iii) recombinant NYVAC(COPAK) virus encoding the same malaria antigen, all at 106 ffu/pfu. A high and statistically significant degree of protection was observed with boosting with recombinant NYVAC (80%) or recombinant MVA (66%). A low and non-significant level of protection (26%) was observed by boosting with the WR recombinant vaccinia virus (Table 9). MVA and NYVAC boosting each gave significantly more protection than WR boosting (P=0.03 and P=0.001 respectively). These data reemphasise that non-replicating pox virus strains are better boosting agents for inducing high levels of protection.
  • TABLE 9
    Influence of Different Recombinant Vaccinia Strains on Protection.
    Immunisation 1 No. inf./ % pro-
    DNA Immunisation 2 No. chall. tection
    CSP MVA.PbCSP  5/15 66
    CSP NYVAC.PbCSP  2/15 80
    CSP WR.PbCSP 11/15 26
    β- galactosidase MVA.NP 8/8 0

    Table 9 Results of challenge experiments using different immunisation regimes of plasmid DNA and replication incompetent vaccinia recombinants as boosting immunisation. BALB/c mice were used in all cases. The immunisation doses were 50 μg of plasmid DNA or 106 ffu/pfu of recombinant MVA or recombinant wild type (WR) vaccinia or recombinant NYVAC. The interval between immunisations 1 and 2 was 23 days. Challenges were performed at 28 days after the last immunisation by i.v. injection of 2000 P. berghei sporozoites and blood films assessed at 7, 9 and 11 days post challenge. PbCSP indicates the entire P. berghei antigen and NP the nucleoprotein antigen of influenza virus (used as a control antigen). The control immunisation was with a plasmid DNA vector expressing β-galactosidase followed by MVA.NP.
    Alternative Routes for Boosting Immune Responses with Recombinant MVA
  • Intravenous injection of recombinant MVA is not a preferred route for immunising humans and not feasible in mass immunisations. Therefore different routes of MVA boosting were tested for their immunogenicity and protective efficacy.
  • Mice were primed with plasmid DNA i.m. Two weeks later they were boosted with MVA administered via the following routes: intravenous (i.v.), subcutaneous (s.c.), intraperitoneal (i.p.), intramuscular (i.p.) and intradermal (i.d.). Two weeks after this boost peptide-specific CD8+ T cells were determined in an ELISPOT assay. The most effective route which induced the highest levels were i.v. and i.d inoculation of MVA. The other routes gave moderate to poor responses (FIG. 12).
  • FIG. 12 shows frequencies of peptide-specific CD8+ T cells following different routes of MVA boosting. Results are shown as the number of spot-forming cells (SFC) per one million splenocytes. Mice were primed with plasmid DNA and two weeks later boosted with MVA via the indicated routes. The number of splenocytes specific for the SYIPSAEKI [SEQ ID NO: 67] peptide was determined in INF-γ ELISPOT assays two weeks after the last immunisation. Each bar represents the mean number of SFCs from three mice assayed individually.
  • Boosting via the i.v. route was compared with the i.d. and i.m route in a challenge experiment. The i.d route gave high levels of protection (80% protection). In the group of animals that were boosted via the i.m. route, 50% of the animals were protected. Complete protection was achieved with MVA boost administered i.v. (Table 10)
  • TABLE 10
    Influence of the Route of MVA Administration
    on Protective Efficacy
    Immunisation
    1 Immunisation 2 No. infected/ % pro-
    DNA MVA No. challenged tection
    CSP CSP i.v. *0/20  100
    CSP CSP i.d 2/10 80
    CSP CSP i.m. 5/10 50
    Epitope epitope i.v. 1/10 90
    NP NP i.v. 10/10  0
    *culminative data from two independent experiments

    Table 10 Results from challenge experiments using different routes of MVA boosting immunisation. Animals were primed by intramuscular plasmid DNA injection and two weeks later boosted with the indicated recombinant MVA (106 ffu/mouse) administered via the routes indicated. The mice were challenged 16 days after the last immunisation with 2000 P. berghei sporozoites and screened for blood stage parasitemia at day 8 and 10 post challenge. Epitope indicates the polypeptide string HM.
  • Alternative Routes of DNA Priming: The Use of a Gene Gun to Prime Peptide Specific Cd8+ T Cells
  • Gene gun delivery is described in detail in for example in Eisenbraun et al. DNA Cell Biol. 1993, 12: 791-797 and Degano et al. Vaccine 1998, 16: 394-398.
  • The mouse malaria challenge experiments described so far using plasmid DNA to prime an immune response used intramuscular injection of plasmid DNA.
  • Intradermal delivery of plasmid DNA using a biolistic device is another route to prime specific CTL responses. Plasmid DNA is coated onto gold particles and delivered intradermally with a gene gun. Groups of mice (n=10) were immunised three times at two weeks intervals with the gene gun alone (4 μg/immunisation), immunised two times with the gene gun followed by an intravenous MVA.PbCSP boost or immunised intramuscularly with 50 μg of pTH.PbCSP and two weeks later boosted with MVA.PbCSP intravenously. Two weeks after the last immunisation the animals were challenged with 2000 sporozoites to assess protective efficacy of each immunisation regimen. In the group that received the intravenous MVA boost following two gene gun immunisations one out of ten animals developed blood stage parasitemia (90% protection). Complete protection was observed with intramuscular DNA priming followed by MVA i.v boosting. Seven out of 10 animals that were immunised three times with the gene gun were infected. (30% protection) (Table 11).
  • Immunisation 1 No. inf./ % pro-
    DNA Immunisation 2 Immunisation 3 No. chall. tection
    gene gun DNA gene gun DNA gene gun DNA 7/10 30
    gene gun DNA gene gun DNA MVA.PbCSP 1/10 90
    DNA i.m MVA.PbCSP 0/10 100
    Naïve 10/10  0

    Table 11 Results of challenge experiments comparing different routes of DNA priming (intradermally by gene gun versus intramuscular needle injection). Groups of BALB/c mice (n=10) were immunised as indicated. Each gene gun immunisation delivered 4 μg of plasmid DNA intraepidermally. For i.m. immunisations 50 mg of plasmid DNA were injected. Twenty days after the last immunisation mice were challenged as described previously.
  • Highly Susceptible C57BL/6 Mice are Protected
  • C57BL/6 mice are very susceptible to P. berghei sporozoite challenge. C57BL/6 mice were immunised using the DNA-MVA prime boost regime with both pre-erythrocytic antigens PbCSP and PbTRAP, and challenged with either 200 or 1000 infectious sporozoites per mouse. (Two hundred sporozoites corresponds to more than twice the dose required to induce infection in this strain). All ten mice challenged with 200 sporozoites showed sterile immunity. Even the group challenged with 1000 sporozoites, 60% of the mice were protected (Table 12). All the naï ve C57BL/6 mice were infected after challenge.
  • TABLE 12
    Protection of C57BL/6 Mice from Sporozoite Challenge
    No. animals inf./ % pro-
    No. challenged tection
    1000 sporozoites
    DNA followed by MVA  4/10 60
    Naïve 5/5 0
     200 sporozoites
    Naïve 5/5 0

    Table 12 Results of a challenge experiment using C57BL/6 mice. Animals were immunised with PbCSP and PbTRAP using the DNA followed by MVA prime boost regime. Fourteen days later the mice were challenged with P. berghei sporozoites as indicated.
  • Example 4 Protective Efficacy of the DNA-priming/MVA-Boosting Regimen in Two Further Disease Models in Mice
  • Following immunogenicity studies, the protective efficacy of the DNA-priming MVA-boosting regimen was tested in two additional murine challenge models. The two challenge models were the P815 tumour model and the influenza A virus challenge model. In both model systems CTL have been shown to mediate protection.
  • P815 Tumour Challenges:
  • Groups (n=10) of DBA/2 mice were immunised with a combination of DNA followed by MVA expressing a tumour epitope string or the HM epitope string. Two weeks after the last immunisation the mice were challenged intravenously with 105 P815 cells. Following this challenge the mice were monitored regularly for the development of tumour-related signs and survival.
  • FIG. 13 shows the survival rate of the two groups of mice. Sixty days after challenge eight out of ten mice were alive in the group immunised with the tumour epitopes string. In the group immunised with the HM epitope string only 2 animals survived. This result is statistically significant: 2/10 vs 8/10 chi-squared=7.2. P=0.007. The onset of death in the groups of animals immunised with the tumour epitope string is delayed compared to the groups immunised with the HM epitope string.
  • Influenza Virus Challenges:
  • Groups of BALB/c mice were immunised with three gene gun immunisations with plasmid DNA, two intramuscular plasmid DNA injections, one i.m. DNA injection followed by one MVA.NP boost i.v. or two gene gun immunisations followed by one MVA.NP boost i.v. Plasmid DNA and recombinant MVA expressed the influenza virus nucleoprotein. Two weeks after the last immunisation the mice were challenged intranasally with 100 HA of influenza A/PR/8/34 virus. The animals were monitored for survival daily after challenge.
  • Complete protection was observed in the following groups of animals:
      • two DNA gene gun immunisations followed by one MVA.NP boost i.v.;
      • one i.m. DNA injection followed by one MVA.NP boost i.v.; and
      • two i.m. DNA injections.
  • In the group of animals immunised three times with the gene gun 71% of the animals survived (5/7) and this difference from the control group was not significant statistically (P>0.05). In the naive group 25% of the animals survived (FIG. 14) and this group differed significantly (P<0.05) for the two completely protected groups.
  • FIG. 14 shows results of an influenza virus challenge experiment. BALB/c mice were immunised as indicated. GG=gene gun immunisations, im=intramuscular injection, iv=intravenous injection. Survival of the animals was monitored daily after challenge. In a second experiment groups of 10 BALB/c mice were immunised with MVA.NP i.v. alone, three times with the gene gun, two times with the gene gun followed by one MVA.NP boost i.v. and two i.m injections of V1J-NP followed by one MVA.NP boost. Two weeks after the last immunisation the mice were challenged with 100 HA units of influenza A/PR/8/34 virus.
  • Complete and statistically significant protection was observed in the following groups of animals:
  • two gene gun immunisations followed by one MVA.NP boost; and two i.m injections of V1J-NP followed by one MVA.NP boost. In the group receiving one MVA.NP i.v., 30% (3 out of 10) of animals survived. In the group immunised with a DNA vaccine delivered by the gene gun three times, 70% of the animals were protected but this protection was not significantly different from the naïve controls. In this challenge experiment 40% (4 out of 10) of the naive animals survived the challenge.
  • Example 5 Immunogenicity Studies in Non-Human Primates Immunogenicity and Protective Efficacy of the Prime Boost Regimen in Non-human Primates.
  • In order to show that the strong immunogenicity of the DNA priming/MVA boosting regime observed in mice translates into strong immunogenicity in primates, the regimen was tested in macaques. The vaccine consisted of a string of CTL epitopes derived from HIV and SIV sequences (FIG. 2), in plasmid DNA or MVA, denoted DNA.H and MVA.H respectively. The use of defined CTL epitopes in a polyepitope string allows testing for SIV specific CTL in macaques. Due to the MHC class I restriction of the antigenic peptides, macaques were screened for their MHC class I haplotype and Mamu-A*01-positive animals were selected for the experiments described.
  • Three animals (CYD, DI and DORIS) were immunised following this immunisation regimen:
  • week 0 DNA (8 μg, i.d., gene gun)
    week 8 DNA (8 μg, i.d., gene gun)
    week 17 MVA (5 × 108 pfu, i.d.)
    week 22 MVA (5 × 108 pfu, i.d.)
  • Blood from each animal was drawn at weeks 0, 2, 5, 8, 10, 11, 17, 18, 19, 21, 22, 23, 24 and 25 of the experiment. The animals were monitored for induction of CTL using two different methods. PBMC isolated from each bleed were re-stimulated in vitro with a peptide encoded in the epitope string and tested for their ability to recognise autologous peptide-loaded target cells in a chromium release cytotoxicity assay. Additionally, freshly isolated PBMC were stained for antigen specific CD8+ T cells using tetramers.
  • Following two gene gun immunisations very low levels of CTL were detected using tetramer staining (FIG. 15). Two weeks after the first MVA boosting, all three animals developed peptide specific CTL as detected by tetramer staining (FIG. 15). This was reflected by the detection of moderate CTL responses following in vitro restimulation (FIG. 16, week 19). The second boost with MVA.H induced very high levels of CD8+, antigen specific T cells (FIG. 15) and also very high levels of peptide specific cytotoxic T cells (FIG. 16, week 23).
  • FIG. 15 shows detection of SIV-specific MHC class I-restricted CD8+ T cells using tetramers. Three Mamu-A*A01-positive macaques were immunised with plasmid DNA (gene gun) followed by MVA boosting as indicated. Frequencies of Mamu-A*A01/CD8 double-positive T cells were identified following FACS analysis. Each bar represents the percentage of CD8+ T cells specific for the Mamu-A*01/gag epitope at the indicated time point. One percent of CD8 T cells corresponds to about 5000/106 peripheral blood lymphocytes. Thus the levels of epitope-specific CD8 T cells in the peripheral blood of these macaques are at least as high as the levels observed in the spleens of immunised and protected mice in the malaria studies.
  • FIG. 16 shows CTL induction in macaques following DNA/MVA immunisation. PBMC from three different macaques (CYD, DI and DORIS) were isolated at week 18, 19 and 23 and were restimulated with peptide CTPYDINQM [SEQ ID NO: 54] in vitro. After two restimulations with peptide CTPYDINQM [SEQ ID NO: 54] the cultures were tested for their lytic activity on peptide-pulsed autologous target cells. Strong CTL activity was observed.
  • Example 6 Immunogenicity and Challenge Studies in Chimpanzees
  • To show that a similar regime of initial immunisation with plasmid DNA and subsequent immunisation with recombinant MVA can be effective against Plasmodium falciparum malaria in higher primates an immunisation and challenge study was performed with two chimpanzees. Chimp H1 received an initial immunisation with 500 μg of a plasmid expressing Plasmodium falciparum TRAP from the CMV promoter without intron A, CMV-TRAP. Chimp H2 received the same dose of CMV-LSA-1, which expresses the C-terminal portion of the LSA-1 gene of P. falciparum. Both chimps received three more immunisations over the next 2 months, but with three plasmids at each immunisation. H1 received CMV-TRAP as before, plus pTH-TRAP, which expresses TRAP using the CMV promoter with intron A, leading to a higher expression level. H1 also received RSV-LSA-1, which expresses the C-terminal portion of LSA-1 from the RSV promoter. H2 received CMV-LSA-1, pTH-LSA-1 and RSV-TRAP at the second, third and fourth immunisations. The dose was always 500 μg of each plasmid.
  • It was subsequently discovered that the RSV plasmids did not express the antigens contained within them, so H1 was only immunised with plasmids expressing TRAP, and H2 with plasmids expressing LSA-1.
  • Between and following these DNA immunisations assays of cellular immune responses were performed at several time points, the last assay being performed at three months following the fourth DNA immunisation, but no malaria-specific T cells were detectable in either ELISPOT assays or CTL assays for CD8+ T cells.
  • Both animals were subsequently immunised with three doses of 108 ffu of a recombinant MVA virus encoding the P. falciparum TRAP antigen over a 6 week period. Just before and also following the third recombinant MVA immunisation T cell responses to the TRAP antigen were detectable in both chimpanzees using an ELISPOT assay to whole TRAP protein bound to latex beads. This assay detects both CD4+ and CD8+ T cell responses. Specific CD8+ T responses were searched for with a series of short 8-11 amino acid peptides in both immunised chimpanzees. Such analysis for CD8+ T cell responses indicated that CD8+ T cells were detectable only in the chimpanzee H1. The target epitope of these CD8+ T lymphocytes was an 11 amino acid peptide from TRAP, tr57, of sequence KTASCGVWDEW [SEQ ID NO: 78]. These CD8+ T cells from H1 had lytic activity against autologous target cells pulsed with the tr57 peptide and against autologous target cells infected with the recombinant PfTRAP-MVA virus. A high precursor frequency of these specific CD8+ T cells of about 1 per 500 lymphocytes was detected in the peripheral blood of this chimpanzee H1 using an ELISPOT assay two months following the final MVA immunisation. No specific CD8+ T cell response was clearly detected in the chimpanzee H2, which was not primed with a plasmid DNA expressing TRAP.
  • Two months after the third PfTRAP-MVA immunisation challenge of H1 and H2 was performed with 20,000 sporozoites, a number that has previously been found to yield reliably detectable blood stage infection in chimpanzees 7 days after challenge (Thomas et al. 1994 and unpublished data). The challenge was performed with the NF54 strain of Plasmodium falciparum. This is of importance because the TRAP sequence in the plasmid DNA and in the recombinant MVA is from the T9/96 strain of P. falciparum which has numerous amino acid differences to the NF54 TRAP allele (Robson et al. 1990). Thus, this sporozoite challenge was performed with a heterologous rather than homologous strain of parasite. In the chimpanzee H2 parasites were detectable in peripheral blood as expected 7 days after sporozoite challenge using in vitro parasite culture detection. However, in H1 the appearance of blood stage parasites in culture from the day 7 blood samples was delayed by three days consistent with some immune protective effect against the liver-stage infection. In studies of previous candidate malaria vaccines in humans a delay in the appearance of parasites in the peripheral blood has been estimated to correspond to a substantial reduction in parasite density in the liver (Davis et al. 1989). Thus the chimpanzee HI, immunised first with P. falciparum TRAP plasmid DNA and subsequently with the same antigen expressed by a recombinant MVA virus showed a strong CD8+ T lymphocyte response and evidence of some protection from heterologous sporozoite challenge.
  • Discussion
  • These examples demonstrate a novel regime for immunisation against malaria which induces high levels of protective CD8+ T cells in rodent models of human malaria infection. Also demonstrated is an unprecedented complete protection against sporozoite challenge using subunit vaccines (36 out of 36 mice protected in Table 6 using DNA priming and MVA boosting with the CS epitope containing vaccines). Induction of protective immune responses using the DNA priming/MVA boosting regimen was demonstrated in two additional mouse models of viral infection influenza A model and cancer (P815 tumour model). More importantly for vaccines for use in humans this immunisation regimen is also highly immunogenic for CD8+ T cells in primates. Strong SIV-gag-specific CTL were induced in 3 out of 3 macaques with plasmid DNA and MVA expressing epitope strings. The levels induced are comparable to those found in SIV-infected animals. The data from the chimpanzee studies indicate that the same immunisation regime can induce a strong CD8+ T lymphocyte response against P. falciparum in higher primates with some evidence of protection against P. falciparum sporozoite challenge.
  • Ty-VLPs have previously been reported to induce good levels of CD8+ T cell responses against the P. berghei rodent malaria (Allsopp et al. 1995) but alone this construct is not protective. It has now been found that subsequent immunisation with recombinant MVA boosts the CD8+ T cell response very substantially and generates a high level of protection (Table 7).
  • Recombinant MVA viruses have not been assessed for efficacy as malaria vaccines previously. Recombinant MVA alone was not significantly protective, nor was priming with recombinant MVA followed by a second immunisation with recombinant plasmid DNA. However, a second immunisation with the recombinant MVA following an initial immunisation with either Ty-VLPs or plasmid DNA yielded impressive levels of protection. Non-recombinant MVA virus has been safely used to vaccinate thousands of human against smallpox and appears to have an excellent safety profile. The molecular basis of the increased safety and immunogenicity of this strain of vaccinia virus is being elucidated by detailed molecular studies (Meyer et al. 1991; Sutter at al. 1994).
  • Plasmid DNA has previously been tested as a malaria vaccine for the P. yoelii rodent malaria. High levels of, but not complete, protection is seen in some strains but in other strains of mice little or no protection was observed even after multiple immunisations (Doolan et al. 1996). Although plasmid DNA has been proposed as a method of immunisation against P. falciparum, success has not previously been achieved. The evidence provided here is the first evidence to show that plasmid DNA may be used in an immunisation regime to induce protective immunity against the human malaria parasite P. falciparum.
  • A similar regime of immunisation to the regime demonstrated herein can be expected to induce useful protective immunity against P. falciparum in humans. It should be noted that five of the vaccine constructs employed in these studies to induce protective immunity in rodents or chimpanzees contain P. falciparum sequences and could therefore be used for human immunisation against P. falciparum. These are: 1. The P. falciparum TRAP plasmid DNA vaccine. 2. The P. falciparum TRAP recombinant MVA virus. 3. The Ty-VLP encoding an epitope string of numerous P falciparum epitopes, as well as the single P. berghei CTL epitope. 4. The plasmid DNA encoding the same epitope string as 3. 5. The recombinant MVA encoding the longer HM epitope string including many of the malaria epitopes in 3 and 4. Similarly the plasmid DNAs and MVA encoding HIV epitopes for human class I molecules could be used in either prophylactic or therapeutic immunisation against HIV infection.
  • These studies have provided clear evidence that a novel sequential immunisation regime employing a non-replicating or replication-impaired pox virus as a boost is capable of inducing a strong protective CD8+ T cell response against the malaria parasite. The examples demonstrate clearly a surprising and substantial enhancement of CD8+ T cell responses and protection compared to replicating strains of pox viruses. Because there is no reason to believe that the immunogenicity of CD8+ T cell epitopes from the malaria parasite should differ substantially from CD8+ T cell epitopes in other antigens it is expected that the immunisation regime described herein will prove effective at generating CD8+ T cell responses of value against other diseases. The critical step in this immunisation regimen is the use of non-replicating or replication-impaired recombinant poxviruses to boost a pre-existing CTL response. We have shown that CTL responses can be primed using different antigen delivery systems such as a DNA vaccine i.d. and i.m, a recombinant Ty-VLP, a recombinant adenovirus and irradiated sporozoites. This is supported by the data presented on the generation of a CD8+ T cell response against HIV, influenza virus and tumours. Amongst several known examples of other diseases against which a CD8+ T cell immune response is important are the following: infection and disease caused by the viruses HIV, herpes simplex, herpes zoster, hepatitis C, hepatitis B, influenza, Epstein-Barr virus, measles, dengue and HTLV-1; by the bacteria Mycobacterium tuberculosis and Listeria sp.; and by the protozoan parasites Toxoplasma and Trypanosoma. Induction of protective CTL responses against influenza A virus has been demonstrated in FIG. 14. Furthermore, the immunisation regime described herein is expected to be of value in immunising against forms of cancer where CD8+ T cell responses plays a protective role. The induction of protective CTL responses using the DNA prime MVA boost regime against tumours is shown in FIG. 13. Specific examples in humans include melanoma, cancer of the breast and cancer of the colon.
  • While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.
  • REFERENCES
    • 1. Nardin E H & Nussenzweig R S. T cell responses to pre-erythrocytic stages of malaria: role in protection and vaccine development against pre-erythrocytic stages. Annual Review of Immunology (1993) 11: 687-727.
    • 2. Hill A V S, Allsopp, C E M, Kwiatkowski D, Anstey N M, Twumasi P, Rowe P A, Bennett S, Brewster D, McMichael A J, Greenwood B M. (1991) Common West African HLA antigens are associated with protection from severe malaria. Nature 352: 595-600.
    • 3. Aidoo M, Lalvani A, Allsopp C E M, et al. Identification of conserved antigenic components for a cytotoxic T lymphocyte-inducing vaccine against malaria. The Lancet. (1995) 345: 1003-1007.
    • 4. Wizel B, Houghten R A, Parker K C, Coligan J E, Church P, Gordon D M, Ballou W R, Hoffman S L. Irradiated sporozoite vaccine induces HLA-B8-restricted cytotoxic T lymphocyte responses against two overlapping epitopes of the Plasmodium falciparum sporozoite surface protein 2. J. Exp Med. (1995) 182: 1435-45.
    • 5. Lalvani A, Aidoo M, Allsopp C E, Plebanski M, Whittle H C, Hill A V. An HLA-based approach to the design of a CTL-inducing vaccine against Plasmodium falciparum. Research in Immunology (1994) 145: 461-8.
    • 6. Seguin M C, Klotz F W, Schneider I, Weir J P, Goodbary M, Slayter M, Raney J J, Aniagolu J U, Green S J. Induction of nitric oxide synthase protects against malaria in mice exposed to irradiated Plasmodium berghei infected mosquitoes: involvement of interferon gamma and CD8+ T cells. J. Exp. Med. (1994) 180: 353-8.
    • 7. Thomas A W, Slierendregt B, Mons B, Druilhe P. Chimpanzees and supporting models in the study of malaria pre-erythrocytic stages. Mem. Inst. Oswaldo Cruz. (1994) 89 Suppl 2: 111-4.
    • 8. Sedegah M, Hedstrom R, Hobart P, Hoffman S L. Protection against malaria by immunization with plasmid DNA encoding circumsporozoite protein. Proc. Natl. Acad. Sci. USA. (1994) 91: 9866-70.
    • 9. Li S, Rodrigues M, Rodriguez D, Rodriguez J R, Esteban M, Palese P, Nussenzweig R S, Zavala F. Priming with recombinant influenza virus followed by administration of recombinant vaccinia virus induces CD8+ T-cell-mediated protective immunity against malaria. Proc. Natl. Acad. Sci. USA. (1993) 90: 5214-8.
    • 10. Lanar D E, Tine J A, de-Taisne C, Seguin M C, Cox W I, Winslow J P, Ware L A, Kauffman E B, Gordon D, Ballou W R, Paoletti E, Sadoff J C. Attenuated vaccinia virus-circumsporozoite protein recombinants confer protection against rodent malaria. Infection and Immunity (1996) 64: 1666-71.
    • 11. Ogg G S, Jin X, Bonhoeffer S, Dunbar P R, Nowak M A, Monard S, Segal J P, Cao Y, Rowland-Jones S L, Cerundolo et al. Quantitation of HIV-1-specific cytotoxic T lymphocytes and plasma load of viral RNA. Science (1998) 279: 2103-6.
    • 12. Ada G. Do cytotoxic T lymphocytes clear some HIV/SIV infections? Journal of Medical Primatology (1996) 25: 158-62.
    • 13. Gallimore A, Cranage M, Cook N, Almond N, Bootman J, Rud E, Silvera P, Dennis M, Corcoran T, Stott J et-al Early suppression of SIV replication by CD8+ nef-specific cytotoxic T cells in vaccinated macaques. Nature Medicine (1995) 1: 1167-73.
    • 14. Mayr A, Hochstein-Mintzel V, Stickl H. Infection (1975) 33: 6-14.
    • 15. Mayr A, Zentralbl Veterinarmed B (1976) 23: 417-30.
    • 16. Mayr A, Stickl H., Muller H K, Danner K, Singer H. Zentralbl Bakteriol B. (1978) 167: 375-90.
    • 17. Stickl H, Hochstein-Mintzel V, Mayr A, Huber H C, Schafer H, Holzner A. Dtsch Med. Wochenschr. (1974) 99: 23866-922.
    • 18. Mahnel H, Mayr A. Berl Munch Tierarztl Wochenschr (1994) 107: 253-6.
    • 19. Meyer H, Sutter G, Mayr A. J Gen Virol. (1991) 72: 1031-8.
    • 20. Altenburger W, Suter C P, Altenburger J. Arch Virol. (1989) 105: 15-27.
    • 21. Sutter G, Ramsey-Ewing A, Rosales R, Moss B. J. Virol. (1994) 68: 4109-16.
    • 22. Sutter G, Moss B. Proc Natl Acad Sci USA (1992) 89: 10847-51.
    • 23. Sutter G W, Wyatt L S, Foley P L, Bennink J R, Moss B. Vaccine (1994). 12: 1032-40.
    • 24. Hirsch V M, Goldstein S, Channock R, et al. Channock R. ed Vaccines 95. Cold Spring Harbor Laboratory Press, (1995) 195-200.
    • 25. Hirsch V M, Fuerst T R, Sutter G, et al. J. Virol. (1996) 70: 3741-52.
    • 26. Moss B, Carroll M W, Wyatt L, et al. In: Anonymous, ed. Vaccines: Novel strategies in design and production. Plenum Pres (1995).
    • 27. Symons J A, Alcami A, Smith G L. Cell. (1995) 81: 551-60.
    • 28. Alcami A, Smith G L. J. Virol. (1995) 69: 4633-9.
    • 29. Alcami A, Smith G L. Cell. (1992) 71: 153-67.
    • 30. Graham K A et al. Virology (1997) 229: 12-24.
    • 31. Alcami A, Smith G L. Proc. Natl. Acad. Sci. USA (1996) 93:11029-34.
    • 32. Blanchard T J, Rowland-Jones S, Gotch F, McMichael A J, Smith GL. Lancet (1997) 348: 1741.
    • 33. McLean C S, Erturk M, Jennings R, Challanain D N, Minson A C, Duncan I, Boursnell M E, Inglis S C. J. Infect. Dis. (1994) 170(5): 1100-9.
    • 34. Davis N L, Brown K W, Johnston R E, J. Virol, (1996) 70(6): 3781-7.
    • 35. Layton G T, Harris S J, Myhan J, West D, Gotch F, Hill-Perkins M, Cole J S, Meyers N, Woodrow S, French T J, Adams S E, Kingsman A J. Induction of single and dual cytotoxic T-lymphocyte responses to viral proteins in mice using recombinant hybrid Ty-virus-like particles. Immunology (1996) 87: 171-8.
    • 36. McGrory-W J; Bautista-D S; Graham-F L A simple technique for the rescue of early region I mutations into infectious human adenovirus type 5. Virology (1988) 163: 614-7.
    • 37. Rodrigues E G, Zavala F, Eichinger D, Wilson J M, Tsuji M. Single immunizing dose of recombinant adenovirus efficiently induces CD8+ T cell-mediated protective immunity against malaria. Journal of Immunology (1997) 158: 1268-74.
    • 38. Davis H L, Michel M L, Whalen R G. DNA-based immunization induces continuous secretion of hepatitis B surface antigen and high levels of circulating antibody. Human Molecular Genetics (1993) 2: 1847-51.
    • 39. Miyahira Y, Murata K, Rodriguez D et al. Quantification of antigen specific CD8+ T cells using an ELISPOT assay. J Immunol Methods (1995) 18: 45-54.
    • 40. Allsopp C E M, Plebanski M, Gilbert S et al. (1996) Comparison of numerous delivery systems for the induction of cytotoxic T lymphocytes. European Journal of Immunology (1996) 26:1951-1959.
    • 41. Rodrigues E G, Zavala F, Eichinger D, Wilson J M, Tsuji M. Single immunizing dose of recombinant adenovirus efficiently induces CD8+ T cell-mediated protective immunity against malaria. J. Immunol. (1997) 158: 1268-74.
    • 42. Schodel F, Wirtz R, Peterson D, Hughes J, Warren R, Sadoff J, Milich D. Immunity to malaria elicited by hybrid hepatitis B virus core particles carrying circumsporozoite protein epitopes. J. Exp. Med. (1994) 180: 1037-46.
    • 43. Satchidanandam V, Zavala F, Moss B. Studies using a recombinant vaccinia virus expressing the circumsporozoite protein of Plasmodium berghei. Mol. Biochem. Parasitol. (1991) 48: 89-99.
    • 44. Davis J R; Murphy J R; Baqar S; Clyde D F; Herrington D A; Levine M M. Estimate of anti-Plasmodium falciparum sporozoite activity in humans vaccinated with synthetic circumsporozoite protein (NANP)3. Transactions of the Royal Society for Tropical Medicine and Hygiene. (1989) 83: 748-50.
    • 45. Meyer, H., Sutter, G. and Mayr, A. (1991). Mapping of deletions in the genome of the highly attenuated vaccinia virus MVA and their influence on virulence. J. Gen. Virol. 72: 1031-38.
    • 46. Sutter G, Wyatt L S, Foley P L, Bennink J R, Moss B. A recombinant vector derived from the host range-restricted and highly attenuated MVA strain of vaccinia virus stimulates protective immunity in mice to influenza virus. Vaccine (1994) 12: 1032-40.
    • 47. Doolan D L, Sedegah M, Hedstrom R C, Hobart P, Charoenvit Y, Hoffman, S L Circumventing genetic restriction of protection against malaria with multigene DNA immunization: CD8+ cell-, interferon gamma-, and nitric oxide-dependent immunity. J. Exp. Med. (1996) 183: 1739-46.
  • 48. Muller H M, Reckmann I, Hollingdale M R, Bujard H, Robson K J, Crisanti A. Thrombospondin related anonymous protein (TRAP) of Plasmodium falciparum binds specifically to sulfated glycoconjugates and to HepG2 hepatoma cells suggesting a role for this molecule in sporozoite invasion of hepatocytes. EMBO-J. (1993) 12: 2881-9.
    • 49. Chakrabarti S et al. Mol. Cell. Biol. (1995) δ: 3403-9.
    • 50. Morrison H G, Bauer S P, Lange J V, Esposito J J, McCormick J B, Auperin D D Protection of guinea pigs from Lassa fever by vaccinia virus recombinants expressing the nucleoprotein or the envelope glycoproteins of Lassa virus. Virology. (1989) 171: 179-88.
    • 51. Mackett M et al. J. Virol. (1984) 49: 857-864.
    • 52. Carroll M W and Moss B E, Biotechnology (1995) 19: 352-4.

Claims (3)

1-9. (canceled)
10. A method for generating a CD8+ T cell immune response in a mammal against at least one target antigen, comprising administering to the mammal at least one dose of each of the following:
(i) a priming composition comprising a source of one or more CD8+ T cell epitopes of the target antigen; and
(ii) a boosting composition comprising a source of one or more CD8+ T cell epitopes of the target antigen, including at least one CD8+ T cell epitope which is the same as a CD8+ T cell epitope of the priming composition, wherein the source of the CD8+ T cell epitopes is a non-replicating or replication-impaired recombinant adenovirus vector;
wherein if the source of epitopes in (i) is a viral vector, the viral vector in (ii) is derived from a different virus;
whereby a CD8+ T cell immune response is generated in the mammal.
11. The method of claim 10, further comprising administering an adjuvant.
US12/940,627 1997-06-09 2010-11-05 Methods and reagents for vaccination which generate a cd8 t cell immune response Abandoned US20110159034A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US12/940,627 US20110159034A1 (en) 1997-06-09 2010-11-05 Methods and reagents for vaccination which generate a cd8 t cell immune response

Applications Claiming Priority (7)

Application Number Priority Date Filing Date Title
GB9711957.2 1997-06-09
GBGB9711957.2A GB9711957D0 (en) 1997-06-09 1997-06-09 Methods and reagents for vaccination
PCT/GB1998/001681 WO1998056919A2 (en) 1997-06-09 1998-06-09 Methods and reagents for vaccination which generate a cd8 t cell immune response
US09/454,204 US6663871B1 (en) 1997-06-09 1999-12-09 Methods and reagents for vaccination which generate a CD8 T cell immune response
US10/653,624 US20040131594A1 (en) 1997-06-09 2003-09-02 Methods and reagents for vaccination which generate a CD8 T cell immune response
US12/221,498 US20090191237A1 (en) 1997-06-09 2008-08-04 Methods and reagents for vaccination which generate A CD8 T cell immune response
US12/940,627 US20110159034A1 (en) 1997-06-09 2010-11-05 Methods and reagents for vaccination which generate a cd8 t cell immune response

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US12/221,498 Continuation US20090191237A1 (en) 1997-06-09 2008-08-04 Methods and reagents for vaccination which generate A CD8 T cell immune response

Publications (1)

Publication Number Publication Date
US20110159034A1 true US20110159034A1 (en) 2011-06-30

Family

ID=10813841

Family Applications (10)

Application Number Title Priority Date Filing Date
US09/454,204 Expired - Lifetime US6663871B1 (en) 1997-06-09 1999-12-09 Methods and reagents for vaccination which generate a CD8 T cell immune response
US10/653,624 Abandoned US20040131594A1 (en) 1997-06-09 2003-09-02 Methods and reagents for vaccination which generate a CD8 T cell immune response
US10/686,943 Abandoned US20040213799A1 (en) 1997-06-09 2003-10-16 Methods and reagents for vaccination which generate a CD8 T cell immune response
US10/833,745 Abandoned US20040191272A1 (en) 1997-06-09 2004-04-28 Methods and reagents for vaccination which generate a CD8 T cell immune response
US10/833,744 Expired - Fee Related US7407661B2 (en) 1997-06-09 2004-04-28 Methods and reagents that generate a CD8 T cell immune response
US10/833,439 Expired - Fee Related US7514087B2 (en) 1997-06-09 2004-04-28 Methods and reagents for immunization which generate a CD8 T cell immune response
US12/221,498 Abandoned US20090191237A1 (en) 1997-06-09 2008-08-04 Methods and reagents for vaccination which generate A CD8 T cell immune response
US12/454,385 Abandoned US20090324632A1 (en) 1997-06-09 2009-05-15 Methods and reagents for vaccination which generate a CD8 T cell immune response
US12/456,699 Abandoned US20100119551A1 (en) 1997-06-09 2009-06-19 Methods and reagents for vaccination which generate a CD8 T cell immune response
US12/940,627 Abandoned US20110159034A1 (en) 1997-06-09 2010-11-05 Methods and reagents for vaccination which generate a cd8 t cell immune response

Family Applications Before (9)

Application Number Title Priority Date Filing Date
US09/454,204 Expired - Lifetime US6663871B1 (en) 1997-06-09 1999-12-09 Methods and reagents for vaccination which generate a CD8 T cell immune response
US10/653,624 Abandoned US20040131594A1 (en) 1997-06-09 2003-09-02 Methods and reagents for vaccination which generate a CD8 T cell immune response
US10/686,943 Abandoned US20040213799A1 (en) 1997-06-09 2003-10-16 Methods and reagents for vaccination which generate a CD8 T cell immune response
US10/833,745 Abandoned US20040191272A1 (en) 1997-06-09 2004-04-28 Methods and reagents for vaccination which generate a CD8 T cell immune response
US10/833,744 Expired - Fee Related US7407661B2 (en) 1997-06-09 2004-04-28 Methods and reagents that generate a CD8 T cell immune response
US10/833,439 Expired - Fee Related US7514087B2 (en) 1997-06-09 2004-04-28 Methods and reagents for immunization which generate a CD8 T cell immune response
US12/221,498 Abandoned US20090191237A1 (en) 1997-06-09 2008-08-04 Methods and reagents for vaccination which generate A CD8 T cell immune response
US12/454,385 Abandoned US20090324632A1 (en) 1997-06-09 2009-05-15 Methods and reagents for vaccination which generate a CD8 T cell immune response
US12/456,699 Abandoned US20100119551A1 (en) 1997-06-09 2009-06-19 Methods and reagents for vaccination which generate a CD8 T cell immune response

Country Status (12)

Country Link
US (10) US6663871B1 (en)
EP (5) EP2058399A1 (en)
JP (2) JP4282095B2 (en)
CN (1) CN100379865C (en)
AT (4) ATE393225T1 (en)
AU (1) AU737780B2 (en)
CA (1) CA2293692C (en)
DE (4) DE69839405T2 (en)
DK (2) DK0979284T4 (en)
ES (1) ES2189185T5 (en)
GB (1) GB9711957D0 (en)
WO (1) WO1998056919A2 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090324702A1 (en) * 2006-02-09 2009-12-31 Shigeto Yoshida Novel viral vector
US20100233202A1 (en) * 2006-02-09 2010-09-16 Shigeto Yoshida Novel viral vector

Families Citing this family (60)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9711957D0 (en) * 1997-06-09 1997-08-06 Isis Innovation Methods and reagents for vaccination
GB0023203D0 (en) 2000-09-21 2000-11-01 Isis Innovation Vaccination method
US20030138454A1 (en) * 1997-06-09 2003-07-24 Oxxon Pharmaccines, Ltd. Vaccination method
JP2002520000A (en) * 1998-05-13 2002-07-09 エピミューン, インコーポレイテッド Expression vector and method of using the vector to stimulate an immune response
SI1117421T1 (en) * 1998-10-05 2004-12-31 Pharamexa A/S Methods for therapeutic vaccination
CA2345817C (en) 1998-10-05 2013-02-12 M&E Biotech A/S Novel methods for therapeutic vaccination
US7148035B1 (en) 1998-11-18 2006-12-12 Oxford Biomedica (Uk) Limited Polypeptide
ATE300314T1 (en) * 1999-01-28 2005-08-15 Stichting Biomedical Primate R COMPOSITION AND METHOD FOR IMMUNIZATION AGAINST ONE OR MORE ANTIGENS USING DIFFERENT RECOMBINANT VECTORS
DE60040662D1 (en) 1999-05-28 2008-12-11 Helmholtz Zentrum Muenchen VECTOR FOR INTEGRATING HETEROLOGIC SEQUENCES IN POXVIRUS GENOMES
WO2001002607A1 (en) 1999-07-06 2001-01-11 Merck & Co., Inc. Adenovirus carrying gag gene hiv vaccine
CA2721011A1 (en) 1999-10-22 2001-05-03 Aventis Pasteur Limited Modified gp100 and uses thereof
CN1213068C (en) 1999-12-23 2005-08-03 医疗研究局 Improvments in or relating to immune responses to HIV
EP1242108B1 (en) * 1999-12-28 2007-07-11 Pharmexa Inc. Optimized minigenes and peptides encoded thereby
US8623379B2 (en) 2000-03-02 2014-01-07 Emory University Compositions and methods for generating an immune response
AU1194802A (en) 2000-03-02 2001-12-11 Univ Emory DNA expression vectors and methods of use
JP2003531865A (en) * 2000-04-28 2003-10-28 アメリカ合衆国 Improving immunogenicity using a combination of DNA and vaccinia virus vector vaccines
US6733993B2 (en) 2000-09-15 2004-05-11 Merck & Co., Inc. Enhanced first generation adenovirus vaccines expressing codon optimized HIV1-gag, pol, nef and modifications
US7241742B2 (en) 2000-10-31 2007-07-10 Mgi Pharma Biologics, Inc. CYP1B1 nucleic acids and methods of use
US7445924B2 (en) 2000-11-23 2008-11-04 Bavarian Nordic A/S Modified Vaccinia Ankara virus variant and cultivation method
UA76731C2 (en) 2000-11-23 2006-09-15 Баваріан Нордік А/С Mva-bn strain of modified vaccinia ankara virus, pharmaceutical composition, vaccine, use of mva-bn strain for vaccine preparation, method for transfer of homologous and/or heterologous nucleic acid sequence into the target cells in vitro, method for preparing peptide or protein, method for obtaining mva-bn strain, host cell, set for primary/buster immunization
US7628980B2 (en) 2000-11-23 2009-12-08 Bavarian Nordic A/S Modified vaccinia virus ankara for the vaccination of neonates
ATE445411T1 (en) 2001-03-08 2009-10-15 Us Gov Health & Human Serv MVA-EXPRESSING MODIFIED HIV ENVELOPE, GAG AND POL GENES
GB0118532D0 (en) 2001-07-30 2001-09-19 Isis Innovation Materials and methods relating to improved vaccination strategies
JP2005517639A (en) * 2001-11-30 2005-06-16 イシス イノベーション リミテッド vaccine
WO2003066833A2 (en) * 2002-02-08 2003-08-14 New York University Use of recombinant hepatitis b core particles to develop vaccines against infectious pathogens and malignancies
EP1485123A2 (en) * 2002-03-13 2004-12-15 Merck & Co., Inc. Method of inducing an enhanced immune response against hiv
KR101028937B1 (en) 2002-04-19 2011-04-12 버베리안 노딕 에이/에스 Modified vaccinia virus ankara for the vaccination of neonates
WO2003097087A1 (en) * 2002-05-20 2003-11-27 Japan Science And Technology Agency Bcg vaccine and utilization thereof
ATE393212T2 (en) 2002-09-05 2008-05-15 Bavarian Nordic As METHOD FOR AMPLIFICATION OF A POXVIRUS IN SERUM-FREE CONDITIONS
US20050031592A1 (en) * 2002-11-13 2005-02-10 Doolan Denise L. Methods and compositions for inducing immune responses and protective immunity by priming with alpha virus replicon vaccines
WO2004056391A1 (en) * 2002-12-20 2004-07-08 The University Of New South Wales A method of immunisation and agents useful for same
US20050175627A1 (en) * 2003-09-24 2005-08-11 Oxxon Therapeutics Ltd. HIV pharmaccines
US20050287068A1 (en) * 2004-06-17 2005-12-29 Bot Adrian I Efficacy of active immunotherapy by integrating diagnostic with therapeutic methods
GB2421025A (en) * 2004-12-09 2006-06-14 Oxxon Therapeutics Ltd HSV vaccination vectors
EP1890724A2 (en) * 2005-05-13 2008-02-27 Oxxon Therapeutics Limited Compositions for inducing an immune response
WO2007004231A1 (en) * 2005-07-04 2007-01-11 Pradeep Seth Hiv-1 vaccinogens with immunomodulators
FR2893254B1 (en) 2005-11-14 2007-12-21 Biomerieux Sa COMPOSITION COMPRISING A BIORESORBABLE COLLOIDAL SYNTHETIC VECTOR AND A VIRAL VECTOR AND ITS PROPHYLACTIC, THERAPEUTIC AND DIAGNOSTIC USE.
JPWO2007102326A1 (en) * 2006-03-07 2009-07-23 公立大学法人横浜市立大学 Powerful immune induction by combined use of adenovirus type 5/35 vector and vaccinia virus MVA vector
EP2462930B1 (en) * 2006-11-09 2017-05-31 The United States Of America As Represented By The Secretary Of The Navy Induction of an immune response against dengue virus using prime-boost approach
US8440202B2 (en) * 2006-11-09 2013-05-14 The United States Of America As Represented By The Secretary Of The Navy Induction of an immune response against dengue virus using the prime-boost approach
GB0706914D0 (en) * 2007-04-10 2007-05-16 Isis Innovation Novel adenovirus vectors
GB0706912D0 (en) * 2007-04-10 2007-05-16 Isis Innovation Novel viral vaccines
WO2009127666A2 (en) * 2008-04-15 2009-10-22 Glaxosmithkline Biologicals S.A. Method and compositions
US8691502B2 (en) * 2008-10-31 2014-04-08 Tremrx, Inc. T-cell vaccination with viral vectors via mechanical epidermal disruption
MX2012004721A (en) 2009-10-23 2012-06-25 Mannkind Corp Cancer immunotherapy and method of treatment.
US20130115234A1 (en) * 2010-03-26 2013-05-09 Emergent Product Development Gaithersburg,Inc. Ectodomains of Influenza Matrix 2 Protein, Expression System, and Uses Thereof
GB201007207D0 (en) 2010-04-29 2010-06-16 Univ Cork Method
WO2012023033A2 (en) 2010-08-18 2012-02-23 Purdue Pharma L.P. Improved peptide immunogens
GB201018480D0 (en) 2010-11-02 2010-12-15 Oxford Biomedica Ltd Factors
EA027236B1 (en) * 2011-04-08 2017-07-31 Иммьюн Дизайн Корп. Immunogenic compositions and methods of using the compositions for inducing humoral and cellular immune responses
WO2014005643A1 (en) * 2012-07-05 2014-01-09 Okairos Ag Novel prime-boosting regimens involving immunogenic polypeptides encoded by polynucleotides
WO2014064534A2 (en) 2012-10-05 2014-05-01 Chrontech Pharma Ab Injection needle, device, immunogenic compositions and method of use
JP6505016B2 (en) * 2012-10-28 2019-04-24 バヴァリアン・ノルディック・アクティーゼルスカブ PR13.5 Promoter and Antibody Response for Robust T Cells
GB201221133D0 (en) 2012-11-23 2013-01-09 Epiontis Gmbh Epigenetic method for the identification of subpopulations of CD8 and T lympocytes, in particular CD8 alpha and beta T lymphocytes
US10576143B2 (en) * 2013-03-15 2020-03-03 Glaxosmithkline Biologicals Sa Poxviral vaccines
WO2014139587A1 (en) 2013-03-15 2014-09-18 Okairòs Ag Improved poxviral vaccines
JP6664338B2 (en) 2014-06-13 2020-03-13 グラクソスミスクライン バイオロジカルズ ソシエテ アノニム Immunogenic combination
WO2017136633A1 (en) * 2016-02-04 2017-08-10 Duke University Cell-based vaccine compositions and methods of use
US11065320B2 (en) * 2016-04-12 2021-07-20 Oxford University Innovation Limited Prime target
KR102609624B1 (en) 2017-03-15 2023-12-05 옥스포드 바이오메디카(유케이) 리미티드 method

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996039178A1 (en) * 1995-06-05 1996-12-12 The Wistar Institute Of Anatomy And Biology A replication-defective adenovirus human type 5 recombinant as a vaccine carrier
US6200798B1 (en) * 1994-09-27 2001-03-13 Rhone-Poulenc Rorer Sa Defective recombinant adenoviruses with inactivated IVa2 gene

Family Cites Families (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2003A (en) * 1841-03-12 Improvement in horizontal windivhlls
US175365A (en) * 1876-03-28 Improvement in sheet-metal-straightening machines
US197349A (en) * 1877-11-20 Improvement in ore-mills
US138454A (en) * 1873-04-29 Improvement in card-racks
US171272A (en) * 1875-12-21 Improvement in school-desks
US131594A (en) * 1872-09-24 Improvement in pulley-blocks
ZA754725B (en) * 1974-08-01 1976-06-30 H Stickl Preparation for the treatment of infectious diseases, method for the manufacture thereof, and its use
US5110587A (en) 1981-12-24 1992-05-05 Health Research, Incorporated Immunogenic composition comprising synthetically modified vaccinia virus
GB8405530D0 (en) * 1984-03-02 1984-04-04 Lysons R J Vaccine for swine dysentery
CA1341245C (en) 1988-01-12 2001-06-05 F. Hoffmann-La Roche Ag Recombinant vaccinia virus mva
US5225336A (en) 1989-03-08 1993-07-06 Health Research Incorporated Recombinant poxvirus host range selection system
CH682669A5 (en) 1989-03-08 1993-10-29 Health Research Inc recombinant virus engineered to express a gene product in a host, corresponding methods and vaccine.
US5462734A (en) * 1990-11-02 1995-10-31 Wisconsin Alumni Research Foundation Bovine herpesvirus vaccine and method of using same
US5766597A (en) * 1991-03-07 1998-06-16 Virogenetics Corporation Malaria recombinant poxviruses
BE1004877A3 (en) 1991-05-27 1993-02-16 Solvay RECOMBINANT AVIPOX VIRUS, CULTURE OF CELLS INFECTED WITH THIS VIRUS AND POULTRY VACCINES DERIVED FROM THIS VIRUS.
JP3504659B2 (en) 1991-06-14 2004-03-08 ヴァイロジェネティクス コーポレイション Immunodeficiency virus recombinant poxvirus vaccine
JPH06509235A (en) 1991-07-26 1994-10-20 ヴァイロジェネティクス コーポレイション Infectious Bursal Disease Virus Recombinant Poxvirus Vaccine
DE69229390T2 (en) * 1991-08-26 1999-11-11 Immuno Ag Direct molecular cloning of a modified genome of a chordopox virus
US5972351A (en) * 1992-04-03 1999-10-26 Isis Innovation Limited Plasmodium falciparum MHC class I-restricted CTL epitopes derived from pre-erythrocytic stage antigens
SG43029A1 (en) 1993-08-11 1997-10-17 American Home Prod Recombinant adenovirus vaccines
DE4341770A1 (en) * 1993-12-08 1995-06-14 Basf Ag Process for the production of lactic acid esters
WO1996003144A1 (en) * 1994-07-27 1996-02-08 The Council Of The Queensland Institute Of Medical Research Polyepitope vaccines
US6001349A (en) * 1995-02-22 1999-12-14 Therion Biologics Corporation Generation of human cytotoxic T-cells specific for carcinoma self-associated antigens and uses thereof
EP0753581A1 (en) 1995-07-10 1997-01-15 Immuno Ag Improved recombinant eukaryotic cytoplasmic viruses, method for their production and their use as vaccines
US5741492A (en) * 1996-01-23 1998-04-21 St. Jude Children's Research Hospital Preparation and use of viral vectors for mixed envelope protein vaccines against human immunodeficiency viruses
US20010036928A1 (en) * 1996-04-22 2001-11-01 Chamberlain Ronald S. Heterologous boosting immunizations
WO1997039771A1 (en) * 1996-04-22 1997-10-30 The Government Of The United States Of America, Represented By The Secretary Of The Department Of Health And Human Services Heterologous boosting immunizations
WO1998004728A1 (en) * 1996-07-25 1998-02-05 Therion Biologics Corporation Recombinant pox virus for immunization against tumor-associated antigens
DE69834179T2 (en) * 1997-02-21 2007-02-01 Oxxon Therapeutics Ltd. RECOMBINANT POX VIRUS THAT CAN NOT EXPRESS THE SOLUBLE CHEMOKINO BINDING PROTEIN ENCODING GENE A41L.
GB9711957D0 (en) * 1997-06-09 1997-08-06 Isis Innovation Methods and reagents for vaccination
US20030138454A1 (en) * 1997-06-09 2003-07-24 Oxxon Pharmaccines, Ltd. Vaccination method
GB0023203D0 (en) 2000-09-21 2000-11-01 Isis Innovation Vaccination method
AU3289199A (en) 1998-02-11 1999-08-30 Maxygen, Inc. Antigen library immunization
US20010036929A1 (en) * 1998-09-25 2001-11-01 Arch Development Corporation. Xrcc3 is required for assembly of Rad51-complexes in vivo
WO2001002607A1 (en) 1999-07-06 2001-01-11 Merck & Co., Inc. Adenovirus carrying gag gene hiv vaccine
ES2233437T3 (en) 1999-08-25 2005-06-16 MERCK &amp; CO., INC. SYNTHETIC GENES OF PAPILOMAVIRUS OPTIMIZED FOR EXPRESSION IN HUMAN CELLS.
GB9922361D0 (en) 1999-09-21 1999-11-24 Isis Innovation Generating an immune response to an antigen
CA2408328C (en) 2000-05-10 2012-04-17 Aventis Pasteur Limited Immunogenic polypeptides encoded by mage minigenes and uses thereof
CU23235A1 (en) 2001-02-28 2007-09-26 Ct Ingenieria Genetica Biotech RECOMBINANT POXVIRUS FOR CHEMICAL PROTEINS OF THE HUMAN IMMUNODEFICIENCY VIRUS AND ITS APPLICATION IN THERAPEUTICS AND AIDS PREVENTION
JP2002271316A (en) * 2001-03-13 2002-09-20 Sanyo Electric Co Ltd Reproducing equipment
CN1164331C (en) 2001-05-23 2004-09-01 中国人民解放军第二军医大学 Human hepatitis B nucleic acid vaccine
JP2005517639A (en) * 2001-11-30 2005-06-16 イシス イノベーション リミテッド vaccine
US20040171272A1 (en) * 2003-02-28 2004-09-02 Applied Materials, Inc. Method of etching metallic materials to form a tapered profile
US6942373B2 (en) * 2003-03-14 2005-09-13 Fiberstars Incorporated Fiberoptic lighting system with shaped collector for efficiency
AU2004273034A1 (en) 2003-09-05 2005-03-24 Sanofi Pasteur Limited Multi-antigen vectors for melanoma
US20050175627A1 (en) * 2003-09-24 2005-08-11 Oxxon Therapeutics Ltd. HIV pharmaccines
JP2007534302A (en) 2003-09-24 2007-11-29 オクソン セラピュティクス リミテッド HIV medicine
GB2421025A (en) 2004-12-09 2006-06-14 Oxxon Therapeutics Ltd HSV vaccination vectors
EP1890724A2 (en) 2005-05-13 2008-02-27 Oxxon Therapeutics Limited Compositions for inducing an immune response
WO2006125983A1 (en) 2005-05-23 2006-11-30 Oxxon Therapeutics Ltd Compositions for inducing an immune response against hepatitis b

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6200798B1 (en) * 1994-09-27 2001-03-13 Rhone-Poulenc Rorer Sa Defective recombinant adenoviruses with inactivated IVa2 gene
WO1996039178A1 (en) * 1995-06-05 1996-12-12 The Wistar Institute Of Anatomy And Biology A replication-defective adenovirus human type 5 recombinant as a vaccine carrier

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
Bridgeman et al (Vaccine, 2010, 28:474-483) *
Drew et al (Vaccine, 2000, 18:2522-2532) *
Rothel et al (Parasite Immunology, May 1997, 19:221-227) *
Wuest et al (Vaccine, 2004, 22:2717-2721) *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090324702A1 (en) * 2006-02-09 2009-12-31 Shigeto Yoshida Novel viral vector
US20100233202A1 (en) * 2006-02-09 2010-09-16 Shigeto Yoshida Novel viral vector
US9023365B2 (en) 2006-02-09 2015-05-05 Educational Foundation Jichi Medical University Recombinant baculovirus vaccine
US9327018B2 (en) 2006-02-09 2016-05-03 Educational Foundation Jichi Medical University Recombinant baculovirus vaccine
US9333249B2 (en) 2006-02-09 2016-05-10 Educational Foundation Jichi Medical University Recombinant baculovirus vaccine

Also Published As

Publication number Publication date
DK1335023T3 (en) 2008-08-18
EP1335023A2 (en) 2003-08-13
CA2293692A1 (en) 1998-12-17
EP0979284A2 (en) 2000-02-16
EP0979284B1 (en) 2003-01-02
DE69839405D1 (en) 2008-06-05
US20040131594A1 (en) 2004-07-08
EP1335023A3 (en) 2005-08-24
US7407661B2 (en) 2008-08-05
GB9711957D0 (en) 1997-08-06
DE69810459D1 (en) 2003-02-06
EP1616954B1 (en) 2008-04-09
DE69839359D1 (en) 2008-05-21
ATE391783T1 (en) 2008-04-15
JP2007023044A (en) 2007-02-01
DE69839357T2 (en) 2009-07-02
US20040197349A1 (en) 2004-10-07
EP1616954A2 (en) 2006-01-18
ATE230437T1 (en) 2003-01-15
CA2293692C (en) 2010-04-27
CN100379865C (en) 2008-04-09
EP2058399A1 (en) 2009-05-13
US7514087B2 (en) 2009-04-07
EP1589108A3 (en) 2006-03-22
JP2002506346A (en) 2002-02-26
EP1616954A9 (en) 2006-12-06
US20090324632A1 (en) 2009-12-31
US20040175365A1 (en) 2004-09-09
ATE391784T1 (en) 2008-04-15
EP1616954A3 (en) 2006-03-22
WO1998056919A2 (en) 1998-12-17
JP4282095B2 (en) 2009-06-17
US6663871B1 (en) 2003-12-16
WO1998056919A3 (en) 1999-06-17
EP1589108A2 (en) 2005-10-26
AU737780B2 (en) 2001-08-30
DE69810459T2 (en) 2003-10-23
ES2189185T3 (en) 2003-07-01
EP1589108A9 (en) 2006-12-06
US20040213799A1 (en) 2004-10-28
EP1589108B1 (en) 2008-04-09
DE69839405T2 (en) 2009-08-20
US20040191272A1 (en) 2004-09-30
ATE393225T1 (en) 2008-05-15
DE69839359T2 (en) 2009-05-20
US20090191237A1 (en) 2009-07-30
ES2189185T5 (en) 2010-09-22
DK0979284T3 (en) 2003-04-22
US20100119551A1 (en) 2010-05-13
AU8026698A (en) 1998-12-30
DK0979284T4 (en) 2010-10-25
DE69810459T3 (en) 2010-12-16
EP0979284B2 (en) 2010-07-07
CN1266459A (en) 2000-09-13
WO1998056919A9 (en) 1999-04-08
DE69839357D1 (en) 2008-05-21
EP1335023B1 (en) 2008-04-23

Similar Documents

Publication Publication Date Title
US7407661B2 (en) Methods and reagents that generate a CD8 T cell immune response
Anderson et al. Enhanced CD8+ T cell immune responses and protection elicited against Plasmodium berghei malaria by prime boost immunization regimens using a novel attenuated fowlpox virus
JP5102930B2 (en) Vaccination method
US20030138454A1 (en) Vaccination method
Gilbert et al. Ty virus-like particles, DNA vaccines and Modified Vaccinia Virus Ankara; comparisons and combinations
US20030185854A1 (en) Use of recombinant hepatitis B core particles to develop vaccines against infectious pathogens and malignancies
US20060127413A1 (en) Recombinant mva strains as potential vaccines against p. falciparum malaria
AU2004203141B2 (en) Methods and reagents for vaccination which generate CD8 T cell immune response
AU775973B2 (en) Methods and reagents for vaccination which generate a CD8 T cell immune response

Legal Events

Date Code Title Description
STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION