US20100330115A1 - Multivariable Antigens Complexed with Targeting Humanized Monoclonal Antibody - Google Patents
Multivariable Antigens Complexed with Targeting Humanized Monoclonal Antibody Download PDFInfo
- Publication number
- US20100330115A1 US20100330115A1 US12/819,618 US81961810A US2010330115A1 US 20100330115 A1 US20100330115 A1 US 20100330115A1 US 81961810 A US81961810 A US 81961810A US 2010330115 A1 US2010330115 A1 US 2010330115A1
- Authority
- US
- United States
- Prior art keywords
- rab
- antigen
- doc
- coh
- cohesin
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 239000000427 antigen Substances 0.000 title claims abstract description 289
- 108091007433 antigens Proteins 0.000 title claims abstract description 275
- 102000036639 antigens Human genes 0.000 title claims abstract description 275
- 230000008685 targeting Effects 0.000 title description 13
- 238000000034 method Methods 0.000 claims abstract description 36
- 239000012634 fragment Substances 0.000 claims abstract description 19
- 108010045512 cohesins Proteins 0.000 claims description 78
- 108090000623 proteins and genes Proteins 0.000 claims description 69
- 210000004027 cell Anatomy 0.000 claims description 65
- 102000004169 proteins and genes Human genes 0.000 claims description 64
- 230000027455 binding Effects 0.000 claims description 49
- 206010028980 Neoplasm Diseases 0.000 claims description 46
- 108020001507 fusion proteins Proteins 0.000 claims description 45
- 102000037865 fusion proteins Human genes 0.000 claims description 45
- 210000004443 dendritic cell Anatomy 0.000 claims description 34
- 150000007523 nucleic acids Chemical class 0.000 claims description 33
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 33
- 239000003053 toxin Substances 0.000 claims description 31
- 231100000765 toxin Toxicity 0.000 claims description 31
- 108700012359 toxins Proteins 0.000 claims description 31
- 229960005486 vaccine Drugs 0.000 claims description 31
- 102000004127 Cytokines Human genes 0.000 claims description 30
- 108090000695 Cytokines Proteins 0.000 claims description 30
- 230000001580 bacterial effect Effects 0.000 claims description 30
- 102000039446 nucleic acids Human genes 0.000 claims description 28
- 108020004707 nucleic acids Proteins 0.000 claims description 28
- -1 CD31 Proteins 0.000 claims description 25
- 230000003612 virological effect Effects 0.000 claims description 23
- 230000000694 effects Effects 0.000 claims description 21
- 238000004519 manufacturing process Methods 0.000 claims description 19
- 239000013598 vector Substances 0.000 claims description 19
- 230000001225 therapeutic effect Effects 0.000 claims description 18
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 17
- 239000003795 chemical substances by application Substances 0.000 claims description 16
- 102000009618 Transforming Growth Factors Human genes 0.000 claims description 15
- 108010009583 Transforming Growth Factors Proteins 0.000 claims description 15
- 239000003102 growth factor Substances 0.000 claims description 15
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 15
- 230000002538 fungal effect Effects 0.000 claims description 14
- 201000011510 cancer Diseases 0.000 claims description 13
- 102000005962 receptors Human genes 0.000 claims description 13
- 108020003175 receptors Proteins 0.000 claims description 13
- 102000004190 Enzymes Human genes 0.000 claims description 12
- 108090000790 Enzymes Proteins 0.000 claims description 12
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 claims description 12
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 claims description 12
- 102000018233 Fibroblast Growth Factor Human genes 0.000 claims description 11
- 108050007372 Fibroblast Growth Factor Proteins 0.000 claims description 11
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 11
- 230000000295 complement effect Effects 0.000 claims description 11
- 230000004927 fusion Effects 0.000 claims description 11
- 229940051026 immunotoxin Drugs 0.000 claims description 11
- 230000002637 immunotoxin Effects 0.000 claims description 11
- 239000002596 immunotoxin Substances 0.000 claims description 11
- 231100000608 immunotoxin Toxicity 0.000 claims description 11
- 208000023275 Autoimmune disease Diseases 0.000 claims description 10
- 102100028667 C-type lectin domain family 4 member A Human genes 0.000 claims description 10
- 101150013553 CD40 gene Proteins 0.000 claims description 10
- 101000766908 Homo sapiens C-type lectin domain family 4 member A Proteins 0.000 claims description 10
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 claims description 10
- 102100037850 Interferon gamma Human genes 0.000 claims description 10
- 108010074328 Interferon-gamma Proteins 0.000 claims description 10
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 claims description 10
- 201000001441 melanoma Diseases 0.000 claims description 9
- 229910052751 metal Inorganic materials 0.000 claims description 9
- 239000002184 metal Substances 0.000 claims description 9
- 238000000746 purification Methods 0.000 claims description 9
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 claims description 8
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 claims description 8
- 239000002671 adjuvant Substances 0.000 claims description 8
- 210000002865 immune cell Anatomy 0.000 claims description 7
- 244000052769 pathogen Species 0.000 claims description 7
- 230000004083 survival effect Effects 0.000 claims description 7
- 108010059616 Activins Proteins 0.000 claims description 6
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 claims description 6
- 241000894006 Bacteria Species 0.000 claims description 6
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 claims description 6
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 claims description 6
- 102000018386 EGF Family of Proteins Human genes 0.000 claims description 6
- 108010066486 EGF Family of Proteins Proteins 0.000 claims description 6
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 claims description 6
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 claims description 6
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 6
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 claims description 6
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 claims description 6
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 claims description 6
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 claims description 6
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 claims description 6
- 102000014429 Insulin-like growth factor Human genes 0.000 claims description 6
- 102100022338 Integrin alpha-M Human genes 0.000 claims description 6
- 102000010789 Interleukin-2 Receptors Human genes 0.000 claims description 6
- 108010038453 Interleukin-2 Receptors Proteins 0.000 claims description 6
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 claims description 6
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 claims description 6
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 claims description 6
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 claims description 6
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 claims description 6
- 239000000488 activin Substances 0.000 claims description 6
- 210000000612 antigen-presenting cell Anatomy 0.000 claims description 6
- 208000032839 leukemia Diseases 0.000 claims description 6
- 239000000758 substrate Substances 0.000 claims description 6
- 102100035248 Alpha-(1,3)-fucosyltransferase 4 Human genes 0.000 claims description 5
- 102100028668 C-type lectin domain family 4 member C Human genes 0.000 claims description 5
- 102100028672 C-type lectin domain family 4 member D Human genes 0.000 claims description 5
- 102100028681 C-type lectin domain family 4 member K Human genes 0.000 claims description 5
- 101710183165 C-type lectin domain family 4 member K Proteins 0.000 claims description 5
- 102100040840 C-type lectin domain family 7 member A Human genes 0.000 claims description 5
- 108010029697 CD40 Ligand Proteins 0.000 claims description 5
- 102100032937 CD40 ligand Human genes 0.000 claims description 5
- 102100032912 CD44 antigen Human genes 0.000 claims description 5
- 102100035793 CD83 antigen Human genes 0.000 claims description 5
- 102100021260 Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 Human genes 0.000 claims description 5
- 101001022185 Homo sapiens Alpha-(1,3)-fucosyltransferase 4 Proteins 0.000 claims description 5
- 101000766907 Homo sapiens C-type lectin domain family 4 member C Proteins 0.000 claims description 5
- 101000766905 Homo sapiens C-type lectin domain family 4 member D Proteins 0.000 claims description 5
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 claims description 5
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 claims description 5
- 101000894906 Homo sapiens Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 Proteins 0.000 claims description 5
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 claims description 5
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 claims description 5
- 101000608935 Homo sapiens Leukosialin Proteins 0.000 claims description 5
- 101001063392 Homo sapiens Lymphocyte function-associated antigen 3 Proteins 0.000 claims description 5
- 101001018258 Homo sapiens Macrophage receptor MARCO Proteins 0.000 claims description 5
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 claims description 5
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 claims description 5
- 101000980827 Homo sapiens T-cell surface glycoprotein CD1a Proteins 0.000 claims description 5
- 101000716149 Homo sapiens T-cell surface glycoprotein CD1b Proteins 0.000 claims description 5
- 101000716124 Homo sapiens T-cell surface glycoprotein CD1c Proteins 0.000 claims description 5
- 108010073807 IgG Receptors Proteins 0.000 claims description 5
- 102000009490 IgG Receptors Human genes 0.000 claims description 5
- 102100025304 Integrin beta-1 Human genes 0.000 claims description 5
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 claims description 5
- 102100039564 Leukosialin Human genes 0.000 claims description 5
- 102100033486 Lymphocyte antigen 75 Human genes 0.000 claims description 5
- 101710157884 Lymphocyte antigen 75 Proteins 0.000 claims description 5
- 102100030984 Lymphocyte function-associated antigen 3 Human genes 0.000 claims description 5
- 102000043129 MHC class I family Human genes 0.000 claims description 5
- 108091054437 MHC class I family Proteins 0.000 claims description 5
- 102000043131 MHC class II family Human genes 0.000 claims description 5
- 108091054438 MHC class II family Proteins 0.000 claims description 5
- 102100033272 Macrophage receptor MARCO Human genes 0.000 claims description 5
- 108010031099 Mannose Receptor Proteins 0.000 claims description 5
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 claims description 5
- 102000016979 Other receptors Human genes 0.000 claims description 5
- 102100024616 Platelet endothelial cell adhesion molecule Human genes 0.000 claims description 5
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 claims description 5
- 102100024219 T-cell surface glycoprotein CD1a Human genes 0.000 claims description 5
- 108010025838 dectin 1 Proteins 0.000 claims description 5
- 229940126864 fibroblast growth factor Drugs 0.000 claims description 5
- 208000005017 glioblastoma Diseases 0.000 claims description 5
- 238000001727 in vivo Methods 0.000 claims description 5
- 210000004072 lung Anatomy 0.000 claims description 5
- 230000001717 pathogenic effect Effects 0.000 claims description 5
- 230000009870 specific binding Effects 0.000 claims description 5
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 claims description 4
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 claims description 4
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 claims description 4
- 102000013462 Interleukin-12 Human genes 0.000 claims description 4
- 108010065805 Interleukin-12 Proteins 0.000 claims description 4
- 102100020873 Interleukin-2 Human genes 0.000 claims description 4
- 108010002350 Interleukin-2 Proteins 0.000 claims description 4
- 108090000978 Interleukin-4 Proteins 0.000 claims description 4
- 102000004388 Interleukin-4 Human genes 0.000 claims description 4
- 206010025323 Lymphomas Diseases 0.000 claims description 4
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 4
- 108010039491 Ricin Proteins 0.000 claims description 4
- 206010043376 Tetanus Diseases 0.000 claims description 4
- 231100000655 enterotoxin Toxicity 0.000 claims description 4
- 230000012010 growth Effects 0.000 claims description 4
- 229960002897 heparin Drugs 0.000 claims description 4
- 229920000669 heparin Polymers 0.000 claims description 4
- 230000003053 immunization Effects 0.000 claims description 4
- 210000003734 kidney Anatomy 0.000 claims description 4
- UBWXUGDQUBIEIZ-UHFFFAOYSA-N (13-methyl-3-oxo-2,6,7,8,9,10,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-17-yl) 3-phenylpropanoate Chemical compound CC12CCC(C3CCC(=O)C=C3CC3)C3C1CCC2OC(=O)CCC1=CC=CC=C1 UBWXUGDQUBIEIZ-UHFFFAOYSA-N 0.000 claims description 3
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 claims description 3
- 108010082808 4-1BB Ligand Proteins 0.000 claims description 3
- 102000005606 Activins Human genes 0.000 claims description 3
- 102400000068 Angiostatin Human genes 0.000 claims description 3
- 108010079709 Angiostatins Proteins 0.000 claims description 3
- 206010003571 Astrocytoma Diseases 0.000 claims description 3
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 claims description 3
- 108010049931 Bone Morphogenetic Protein 2 Proteins 0.000 claims description 3
- 108010049951 Bone Morphogenetic Protein 3 Proteins 0.000 claims description 3
- 108010049955 Bone Morphogenetic Protein 4 Proteins 0.000 claims description 3
- 108010049976 Bone Morphogenetic Protein 5 Proteins 0.000 claims description 3
- 108010049974 Bone Morphogenetic Protein 6 Proteins 0.000 claims description 3
- 108010049870 Bone Morphogenetic Protein 7 Proteins 0.000 claims description 3
- 102000007350 Bone Morphogenetic Proteins Human genes 0.000 claims description 3
- 108010007726 Bone Morphogenetic Proteins Proteins 0.000 claims description 3
- 102100028728 Bone morphogenetic protein 1 Human genes 0.000 claims description 3
- 108090000654 Bone morphogenetic protein 1 Proteins 0.000 claims description 3
- 102100024506 Bone morphogenetic protein 2 Human genes 0.000 claims description 3
- 102100024504 Bone morphogenetic protein 3 Human genes 0.000 claims description 3
- 102100024505 Bone morphogenetic protein 4 Human genes 0.000 claims description 3
- 102100022526 Bone morphogenetic protein 5 Human genes 0.000 claims description 3
- 102100022525 Bone morphogenetic protein 6 Human genes 0.000 claims description 3
- 102100022544 Bone morphogenetic protein 7 Human genes 0.000 claims description 3
- 102100022545 Bone morphogenetic protein 8B Human genes 0.000 claims description 3
- 208000018084 Bone neoplasm Diseases 0.000 claims description 3
- 206010006187 Breast cancer Diseases 0.000 claims description 3
- 208000026310 Breast neoplasm Diseases 0.000 claims description 3
- 101710098275 C-X-C motif chemokine 10 Proteins 0.000 claims description 3
- 101150093802 CXCL1 gene Proteins 0.000 claims description 3
- 102000019034 Chemokines Human genes 0.000 claims description 3
- 108010012236 Chemokines Proteins 0.000 claims description 3
- 102100031162 Collagen alpha-1(XVIII) chain Human genes 0.000 claims description 3
- 206010009944 Colon cancer Diseases 0.000 claims description 3
- 102000007644 Colony-Stimulating Factors Human genes 0.000 claims description 3
- 108010071942 Colony-Stimulating Factors Proteins 0.000 claims description 3
- 208000002699 Digestive System Neoplasms Diseases 0.000 claims description 3
- 102100040897 Embryonic growth/differentiation factor 1 Human genes 0.000 claims description 3
- 108010079505 Endostatins Proteins 0.000 claims description 3
- 102000003951 Erythropoietin Human genes 0.000 claims description 3
- 108090000394 Erythropoietin Proteins 0.000 claims description 3
- 101001043796 Gallus gallus Interleukin-8 Proteins 0.000 claims description 3
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 claims description 3
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 claims description 3
- 108010090296 Growth Differentiation Factor 1 Proteins 0.000 claims description 3
- 108010090290 Growth Differentiation Factor 2 Proteins 0.000 claims description 3
- 102100040892 Growth/differentiation factor 2 Human genes 0.000 claims description 3
- 102100039939 Growth/differentiation factor 8 Human genes 0.000 claims description 3
- 208000017604 Hodgkin disease Diseases 0.000 claims description 3
- 208000010747 Hodgkins lymphoma Diseases 0.000 claims description 3
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 claims description 3
- 101000899368 Homo sapiens Bone morphogenetic protein 8B Proteins 0.000 claims description 3
- 101001002634 Homo sapiens Interleukin-1 alpha Proteins 0.000 claims description 3
- 101000998146 Homo sapiens Interleukin-17A Proteins 0.000 claims description 3
- 101001033279 Homo sapiens Interleukin-3 Proteins 0.000 claims description 3
- 101000764294 Homo sapiens Lymphotoxin-beta Proteins 0.000 claims description 3
- 101000582950 Homo sapiens Platelet factor 4 Proteins 0.000 claims description 3
- 101000638251 Homo sapiens Tumor necrosis factor ligand superfamily member 9 Proteins 0.000 claims description 3
- 102000026633 IL6 Human genes 0.000 claims description 3
- 108091058560 IL8 Proteins 0.000 claims description 3
- 102100026818 Inhibin beta E chain Human genes 0.000 claims description 3
- 108010004250 Inhibins Proteins 0.000 claims description 3
- 102000002746 Inhibins Human genes 0.000 claims description 3
- 102100026720 Interferon beta Human genes 0.000 claims description 3
- 102000006992 Interferon-alpha Human genes 0.000 claims description 3
- 108010047761 Interferon-alpha Proteins 0.000 claims description 3
- 108090000467 Interferon-beta Proteins 0.000 claims description 3
- 102100020881 Interleukin-1 alpha Human genes 0.000 claims description 3
- 108090000174 Interleukin-10 Proteins 0.000 claims description 3
- 108090000177 Interleukin-11 Proteins 0.000 claims description 3
- 102000003816 Interleukin-13 Human genes 0.000 claims description 3
- 108090000176 Interleukin-13 Proteins 0.000 claims description 3
- 101800003050 Interleukin-16 Proteins 0.000 claims description 3
- 102000049772 Interleukin-16 Human genes 0.000 claims description 3
- 102100033461 Interleukin-17A Human genes 0.000 claims description 3
- 102100039064 Interleukin-3 Human genes 0.000 claims description 3
- 102000000743 Interleukin-5 Human genes 0.000 claims description 3
- 108010002616 Interleukin-5 Proteins 0.000 claims description 3
- 108090001005 Interleukin-6 Proteins 0.000 claims description 3
- 102000000704 Interleukin-7 Human genes 0.000 claims description 3
- 108010002586 Interleukin-7 Proteins 0.000 claims description 3
- 102000004890 Interleukin-8 Human genes 0.000 claims description 3
- 108090001007 Interleukin-8 Proteins 0.000 claims description 3
- 102000000585 Interleukin-9 Human genes 0.000 claims description 3
- 108010002335 Interleukin-9 Proteins 0.000 claims description 3
- 102000015696 Interleukins Human genes 0.000 claims description 3
- 108010063738 Interleukins Proteins 0.000 claims description 3
- 102000016267 Leptin Human genes 0.000 claims description 3
- 108010092277 Leptin Proteins 0.000 claims description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 3
- 102000004083 Lymphotoxin-alpha Human genes 0.000 claims description 3
- 108090000542 Lymphotoxin-alpha Proteins 0.000 claims description 3
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 claims description 3
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 claims description 3
- 208000032271 Malignant tumor of penis Diseases 0.000 claims description 3
- 102000018697 Membrane Proteins Human genes 0.000 claims description 3
- 108010052285 Membrane Proteins Proteins 0.000 claims description 3
- 208000034578 Multiple myelomas Diseases 0.000 claims description 3
- 108010056852 Myostatin Proteins 0.000 claims description 3
- 102000015336 Nerve Growth Factor Human genes 0.000 claims description 3
- 108010025020 Nerve Growth Factor Proteins 0.000 claims description 3
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims description 3
- 206010033128 Ovarian cancer Diseases 0.000 claims description 3
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 3
- 208000002471 Penile Neoplasms Diseases 0.000 claims description 3
- 206010034299 Penile cancer Diseases 0.000 claims description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 3
- 206010060862 Prostate cancer Diseases 0.000 claims description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 3
- 208000024313 Testicular Neoplasms Diseases 0.000 claims description 3
- 206010057644 Testis cancer Diseases 0.000 claims description 3
- 102000046299 Transforming Growth Factor beta1 Human genes 0.000 claims description 3
- 102000011117 Transforming Growth Factor beta2 Human genes 0.000 claims description 3
- 101800002279 Transforming growth factor beta-1 Proteins 0.000 claims description 3
- 101800000304 Transforming growth factor beta-2 Proteins 0.000 claims description 3
- 102000056172 Transforming growth factor beta-3 Human genes 0.000 claims description 3
- 108090000097 Transforming growth factor beta-3 Proteins 0.000 claims description 3
- 108060008682 Tumor Necrosis Factor Proteins 0.000 claims description 3
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 claims description 3
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims description 3
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 3
- 108010023082 activin A Proteins 0.000 claims description 3
- 108010023079 activin B Proteins 0.000 claims description 3
- 239000002870 angiogenesis inducing agent Substances 0.000 claims description 3
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 claims description 3
- 230000009286 beneficial effect Effects 0.000 claims description 3
- 210000003445 biliary tract Anatomy 0.000 claims description 3
- 229940112869 bone morphogenetic protein Drugs 0.000 claims description 3
- 210000004556 brain Anatomy 0.000 claims description 3
- 210000000621 bronchi Anatomy 0.000 claims description 3
- 210000003679 cervix uteri Anatomy 0.000 claims description 3
- 208000029742 colonic neoplasm Diseases 0.000 claims description 3
- 229940047120 colony stimulating factors Drugs 0.000 claims description 3
- 210000002808 connective tissue Anatomy 0.000 claims description 3
- 230000004069 differentiation Effects 0.000 claims description 3
- 229940105423 erythropoietin Drugs 0.000 claims description 3
- 210000003238 esophagus Anatomy 0.000 claims description 3
- 210000000232 gallbladder Anatomy 0.000 claims description 3
- 206010017758 gastric cancer Diseases 0.000 claims description 3
- 230000002496 gastric effect Effects 0.000 claims description 3
- 201000010536 head and neck cancer Diseases 0.000 claims description 3
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 3
- 244000000013 helminth Species 0.000 claims description 3
- 230000002489 hematologic effect Effects 0.000 claims description 3
- 102000055414 human LTB Human genes 0.000 claims description 3
- 238000002649 immunization Methods 0.000 claims description 3
- 208000015181 infectious disease Diseases 0.000 claims description 3
- 239000000893 inhibin Substances 0.000 claims description 3
- 108010067471 inhibin A Proteins 0.000 claims description 3
- 108010067479 inhibin B Proteins 0.000 claims description 3
- 229940047122 interleukins Drugs 0.000 claims description 3
- 210000000867 larynx Anatomy 0.000 claims description 3
- 229940039781 leptin Drugs 0.000 claims description 3
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 claims description 3
- 210000000088 lip Anatomy 0.000 claims description 3
- 201000007270 liver cancer Diseases 0.000 claims description 3
- 208000014018 liver neoplasm Diseases 0.000 claims description 3
- 201000005202 lung cancer Diseases 0.000 claims description 3
- 208000020816 lung neoplasm Diseases 0.000 claims description 3
- 108010053292 macrophage stimulating protein Proteins 0.000 claims description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 3
- 230000002297 mitogenic effect Effects 0.000 claims description 3
- 210000000214 mouth Anatomy 0.000 claims description 3
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 claims description 3
- 210000001989 nasopharynx Anatomy 0.000 claims description 3
- 210000000653 nervous system Anatomy 0.000 claims description 3
- 230000000926 neurological effect Effects 0.000 claims description 3
- 230000002188 osteogenic effect Effects 0.000 claims description 3
- 201000002528 pancreatic cancer Diseases 0.000 claims description 3
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 3
- 210000003800 pharynx Anatomy 0.000 claims description 3
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 claims description 3
- 210000000664 rectum Anatomy 0.000 claims description 3
- 238000012216 screening Methods 0.000 claims description 3
- 201000011549 stomach cancer Diseases 0.000 claims description 3
- 201000003120 testicular cancer Diseases 0.000 claims description 3
- 210000001685 thyroid gland Anatomy 0.000 claims description 3
- 210000003932 urinary bladder Anatomy 0.000 claims description 3
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 claims description 3
- 210000004291 uterus Anatomy 0.000 claims description 3
- 206010046885 vaginal cancer Diseases 0.000 claims description 3
- 208000013139 vaginal neoplasm Diseases 0.000 claims description 3
- 208000020416 vascular bone neoplasm Diseases 0.000 claims description 3
- 201000011531 vascular cancer Diseases 0.000 claims description 3
- 108010066676 Abrin Proteins 0.000 claims description 2
- 229930195730 Aflatoxin Natural products 0.000 claims description 2
- 101710092462 Alpha-hemolysin Proteins 0.000 claims description 2
- 101710197219 Alpha-toxin Proteins 0.000 claims description 2
- 108030001720 Bontoxilysin Proteins 0.000 claims description 2
- 206010008631 Cholera Diseases 0.000 claims description 2
- 208000035473 Communicable disease Diseases 0.000 claims description 2
- SRUWWOSWHXIIIA-UKPGNTDSSA-N Cyanoginosin Chemical compound N1C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](C)[C@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)C(=C)N(C)C(=O)CC[C@H](C(O)=O)N(C)C(=O)[C@@H](C)[C@@H]1\C=C\C(\C)=C\[C@H](C)[C@@H](O)CC1=CC=CC=C1 SRUWWOSWHXIIIA-UKPGNTDSSA-N 0.000 claims description 2
- 101000867232 Escherichia coli Heat-stable enterotoxin II Proteins 0.000 claims description 2
- 241000233866 Fungi Species 0.000 claims description 2
- 108010034145 Helminth Proteins Proteins 0.000 claims description 2
- 102000003812 Interleukin-15 Human genes 0.000 claims description 2
- 108090000172 Interleukin-15 Proteins 0.000 claims description 2
- 102000003810 Interleukin-18 Human genes 0.000 claims description 2
- 108090000171 Interleukin-18 Proteins 0.000 claims description 2
- 231100000678 Mycotoxin Toxicity 0.000 claims description 2
- 101710124951 Phospholipase C Proteins 0.000 claims description 2
- 108010079723 Shiga Toxin Proteins 0.000 claims description 2
- 239000005409 aflatoxin Substances 0.000 claims description 2
- 239000002776 alpha toxin Substances 0.000 claims description 2
- 230000004663 cell proliferation Effects 0.000 claims description 2
- 206010013023 diphtheria Diseases 0.000 claims description 2
- 239000002636 mycotoxin Substances 0.000 claims description 2
- 238000001742 protein purification Methods 0.000 claims description 2
- 230000002285 radioactive effect Effects 0.000 claims description 2
- RPQXVSUAYFXFJA-HGRQIUPRSA-N saxitoxin Chemical compound NC(=O)OC[C@@H]1N=C(N)N2CCC(O)(O)[C@@]22N=C(N)N[C@@H]12 RPQXVSUAYFXFJA-HGRQIUPRSA-N 0.000 claims description 2
- RPQXVSUAYFXFJA-UHFFFAOYSA-N saxitoxin hydrate Natural products NC(=O)OCC1N=C(N)N2CCC(O)(O)C22NC(N)=NC12 RPQXVSUAYFXFJA-UHFFFAOYSA-N 0.000 claims description 2
- 239000003998 snake venom Substances 0.000 claims description 2
- 239000002708 spider venom Substances 0.000 claims description 2
- CFMYXEVWODSLAX-QOZOJKKESA-N tetrodotoxin Chemical compound O([C@@]([C@H]1O)(O)O[C@H]2[C@@]3(O)CO)[C@H]3[C@@H](O)[C@]11[C@H]2[C@@H](O)N=C(N)N1 CFMYXEVWODSLAX-QOZOJKKESA-N 0.000 claims description 2
- 229950010357 tetrodotoxin Drugs 0.000 claims description 2
- CFMYXEVWODSLAX-UHFFFAOYSA-N tetrodotoxin Natural products C12C(O)NC(=N)NC2(C2O)C(O)C3C(CO)(O)C1OC2(O)O3 CFMYXEVWODSLAX-UHFFFAOYSA-N 0.000 claims description 2
- 238000002054 transplantation Methods 0.000 claims description 2
- 102000003814 Interleukin-10 Human genes 0.000 claims 1
- 102100030694 Interleukin-11 Human genes 0.000 claims 1
- 102000049853 macrophage stimulating protein Human genes 0.000 claims 1
- 239000000203 mixture Substances 0.000 abstract description 37
- 235000018102 proteins Nutrition 0.000 description 60
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 49
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 49
- 206010022000 influenza Diseases 0.000 description 43
- 150000001413 amino acids Chemical group 0.000 description 32
- 230000003993 interaction Effects 0.000 description 29
- 238000005516 engineering process Methods 0.000 description 20
- 239000000047 product Substances 0.000 description 18
- 230000028327 secretion Effects 0.000 description 17
- 108091026890 Coding region Proteins 0.000 description 16
- 108020004414 DNA Proteins 0.000 description 16
- 238000002255 vaccination Methods 0.000 description 15
- 210000004899 c-terminal region Anatomy 0.000 description 14
- 210000004962 mammalian cell Anatomy 0.000 description 14
- 239000006228 supernatant Substances 0.000 description 14
- 101710120037 Toxin CcdB Proteins 0.000 description 13
- 241000588724 Escherichia coli Species 0.000 description 12
- 101150030083 PE38 gene Proteins 0.000 description 11
- 238000001042 affinity chromatography Methods 0.000 description 11
- 238000004458 analytical method Methods 0.000 description 11
- 229940088598 enzyme Drugs 0.000 description 11
- 239000013613 expression plasmid Substances 0.000 description 11
- 238000009472 formulation Methods 0.000 description 11
- 238000011282 treatment Methods 0.000 description 11
- 238000002156 mixing Methods 0.000 description 10
- 108091033319 polynucleotide Proteins 0.000 description 10
- 102000040430 polynucleotide Human genes 0.000 description 10
- 239000002157 polynucleotide Substances 0.000 description 10
- 101100532679 Caenorhabditis elegans scc-1 gene Proteins 0.000 description 9
- 230000004988 N-glycosylation Effects 0.000 description 9
- 238000011534 incubation Methods 0.000 description 9
- 238000005304 joining Methods 0.000 description 9
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 8
- 108091028043 Nucleic acid sequence Proteins 0.000 description 8
- 239000004480 active ingredient Substances 0.000 description 8
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 description 7
- 108090001030 Lipoproteins Proteins 0.000 description 7
- 102000004895 Lipoproteins Human genes 0.000 description 7
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 7
- 241000193448 Ruminiclostridium thermocellum Species 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 230000028993 immune response Effects 0.000 description 7
- 238000002965 ELISA Methods 0.000 description 6
- 241000725303 Human immunodeficiency virus Species 0.000 description 6
- 108700033844 Pseudomonas aeruginosa toxA Proteins 0.000 description 6
- 239000001913 cellulose Substances 0.000 description 6
- 229920002678 cellulose Polymers 0.000 description 6
- 201000010099 disease Diseases 0.000 description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 6
- 238000000338 in vitro Methods 0.000 description 6
- 108020001580 protein domains Proteins 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 241000193738 Bacillus anthracis Species 0.000 description 5
- 108010037897 DC-specific ICAM-3 grabbing nonintegrin Proteins 0.000 description 5
- 206010020751 Hypersensitivity Diseases 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 230000004989 O-glycosylation Effects 0.000 description 5
- 102100033138 Tyrosine-protein phosphatase non-receptor type 22 Human genes 0.000 description 5
- NKLPQNGYXWVELD-UHFFFAOYSA-M coomassie brilliant blue Chemical compound [Na+].C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=2C=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=C1 NKLPQNGYXWVELD-UHFFFAOYSA-M 0.000 description 5
- 230000000593 degrading effect Effects 0.000 description 5
- 238000010790 dilution Methods 0.000 description 5
- 239000012895 dilution Substances 0.000 description 5
- 230000013595 glycosylation Effects 0.000 description 5
- 238000006206 glycosylation reaction Methods 0.000 description 5
- 239000000825 pharmaceutical preparation Substances 0.000 description 5
- 229920001184 polypeptide Polymers 0.000 description 5
- 230000035755 proliferation Effects 0.000 description 5
- 230000001681 protective effect Effects 0.000 description 5
- 229940051173 recombinant immunotoxin Drugs 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 150000003839 salts Chemical class 0.000 description 5
- 238000010186 staining Methods 0.000 description 5
- 102000007592 Apolipoproteins Human genes 0.000 description 4
- 108010071619 Apolipoproteins Proteins 0.000 description 4
- 230000004568 DNA-binding Effects 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 4
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 4
- 108010085220 Multiprotein Complexes Proteins 0.000 description 4
- 102000007474 Multiprotein Complexes Human genes 0.000 description 4
- 206010037742 Rabies Diseases 0.000 description 4
- 101800001271 Surface protein Proteins 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 230000003213 activating effect Effects 0.000 description 4
- 208000026935 allergic disease Diseases 0.000 description 4
- 230000007815 allergy Effects 0.000 description 4
- 235000001014 amino acid Nutrition 0.000 description 4
- 230000000890 antigenic effect Effects 0.000 description 4
- 230000001640 apoptogenic effect Effects 0.000 description 4
- 230000037396 body weight Effects 0.000 description 4
- 239000012228 culture supernatant Substances 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 150000004676 glycans Chemical class 0.000 description 4
- 229940088597 hormone Drugs 0.000 description 4
- 239000005556 hormone Substances 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 230000000977 initiatory effect Effects 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- 239000008194 pharmaceutical composition Substances 0.000 description 4
- 229940127557 pharmaceutical product Drugs 0.000 description 4
- 229920001282 polysaccharide Polymers 0.000 description 4
- 239000005017 polysaccharide Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 238000002560 therapeutic procedure Methods 0.000 description 4
- 210000000605 viral structure Anatomy 0.000 description 4
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 3
- 229920000324 Cellulosome Polymers 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 102100035353 Cyclin-dependent kinase 2-associated protein 1 Human genes 0.000 description 3
- 206010014596 Encephalitis Japanese B Diseases 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 241000606768 Haemophilus influenzae Species 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 3
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 3
- 201000005807 Japanese encephalitis Diseases 0.000 description 3
- 241000710842 Japanese encephalitis virus Species 0.000 description 3
- 241000712079 Measles morbillivirus Species 0.000 description 3
- 108010063954 Mucins Proteins 0.000 description 3
- 102000015728 Mucins Human genes 0.000 description 3
- 102100025386 Oxidized low-density lipoprotein receptor 1 Human genes 0.000 description 3
- 101710199789 Oxidized low-density lipoprotein receptor 1 Proteins 0.000 description 3
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 3
- 102100038358 Prostate-specific antigen Human genes 0.000 description 3
- 241000725643 Respiratory syncytial virus Species 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 206010052779 Transplant rejections Diseases 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 239000013543 active substance Substances 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 210000000166 cellulosome Anatomy 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 108010061181 influenza matrix peptide (58-66) Proteins 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 230000002147 killing effect Effects 0.000 description 3
- 230000003071 parasitic effect Effects 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- 230000004850 protein–protein interaction Effects 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 239000000829 suppository Substances 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 229940124597 therapeutic agent Drugs 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- XBMULXNXJLWLLD-UHFFFAOYSA-N 4,5-bis(4-methoxyphenyl)-2-thiophen-2-yl-1h-imidazole Chemical compound C1=CC(OC)=CC=C1C1=C(C=2C=CC(OC)=CC=2)NC(C=2SC=CC=2)=N1 XBMULXNXJLWLLD-UHFFFAOYSA-N 0.000 description 2
- XHVDVFNHQJLOBV-UHFFFAOYSA-N 5-[(4-fluoroimidazol-1-yl)methyl]quinolin-8-ol Chemical compound Oc1ccc(Cn2cnc(F)c2)c2cccnc12 XHVDVFNHQJLOBV-UHFFFAOYSA-N 0.000 description 2
- 102100038222 60 kDa heat shock protein, mitochondrial Human genes 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 2
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 2
- 102100035526 B melanoma antigen 1 Human genes 0.000 description 2
- 101100476210 Caenorhabditis elegans rnt-1 gene Proteins 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 108010058432 Chaperonin 60 Proteins 0.000 description 2
- 101710098119 Chaperonin GroEL 2 Proteins 0.000 description 2
- 108010009685 Cholinergic Receptors Proteins 0.000 description 2
- 208000011231 Crohn disease Diseases 0.000 description 2
- 208000001490 Dengue Diseases 0.000 description 2
- 206010012310 Dengue fever Diseases 0.000 description 2
- 201000004624 Dermatitis Diseases 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 102000001301 EGF receptor Human genes 0.000 description 2
- 108060006698 EGF receptor Proteins 0.000 description 2
- 101710146739 Enterotoxin Proteins 0.000 description 2
- 108010008655 Epstein-Barr Virus Nuclear Antigens Proteins 0.000 description 2
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 2
- 108091022930 Glutamate decarboxylase Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 108010088729 HLA-A*02:01 antigen Proteins 0.000 description 2
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 2
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 2
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 2
- 241000700721 Hepatitis B virus Species 0.000 description 2
- 208000005176 Hepatitis C Diseases 0.000 description 2
- 102100032813 Hepatocyte growth factor-like protein Human genes 0.000 description 2
- 208000009889 Herpes Simplex Diseases 0.000 description 2
- 208000007514 Herpes zoster Diseases 0.000 description 2
- 241000228402 Histoplasma Species 0.000 description 2
- 101000874316 Homo sapiens B melanoma antigen 1 Proteins 0.000 description 2
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 2
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 2
- 241000701806 Human papillomavirus Species 0.000 description 2
- 102000026659 IL10 Human genes 0.000 description 2
- HEFNNWSXXWATRW-UHFFFAOYSA-N Ibuprofen Chemical compound CC(C)CC1=CC=C(C(C)C(O)=O)C=C1 HEFNNWSXXWATRW-UHFFFAOYSA-N 0.000 description 2
- 102000003815 Interleukin-11 Human genes 0.000 description 2
- 101710085938 Matrix protein Proteins 0.000 description 2
- 201000005505 Measles Diseases 0.000 description 2
- 101710127721 Membrane protein Proteins 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 208000001132 Osteoporosis Diseases 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- 241000223960 Plasmodium falciparum Species 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 241001495182 Pseudobacteroides cellulosolvens Species 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 208000021386 Sjogren Syndrome Diseases 0.000 description 2
- 241000191940 Staphylococcus Species 0.000 description 2
- 108010023197 Streptokinase Proteins 0.000 description 2
- 102000019197 Superoxide Dismutase Human genes 0.000 description 2
- 108010012715 Superoxide dismutase Proteins 0.000 description 2
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 2
- 102000011923 Thyrotropin Human genes 0.000 description 2
- 108010061174 Thyrotropin Proteins 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 241000700647 Variola virus Species 0.000 description 2
- 108010067390 Viral Proteins Proteins 0.000 description 2
- 102000034337 acetylcholine receptors Human genes 0.000 description 2
- 229960001138 acetylsalicylic acid Drugs 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 108060000200 adenylate cyclase Proteins 0.000 description 2
- 102000030621 adenylate cyclase Human genes 0.000 description 2
- 229940035676 analgesics Drugs 0.000 description 2
- 239000000730 antalgic agent Substances 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 239000002260 anti-inflammatory agent Substances 0.000 description 2
- 229940121363 anti-inflammatory agent Drugs 0.000 description 2
- 230000001754 anti-pyretic effect Effects 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 239000003146 anticoagulant agent Substances 0.000 description 2
- 229940127219 anticoagulant drug Drugs 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 239000002221 antipyretic Substances 0.000 description 2
- 229940125716 antipyretic agent Drugs 0.000 description 2
- 208000006673 asthma Diseases 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 230000009918 complex formation Effects 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 208000025729 dengue disease Diseases 0.000 description 2
- 206010012601 diabetes mellitus Diseases 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 239000000147 enterotoxin Substances 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- 238000001415 gene therapy Methods 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 239000000185 hemagglutinin Substances 0.000 description 2
- 208000006454 hepatitis Diseases 0.000 description 2
- 231100000283 hepatitis Toxicity 0.000 description 2
- 208000002672 hepatitis B Diseases 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 210000003000 inclusion body Anatomy 0.000 description 2
- 208000037797 influenza A Diseases 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 108700025647 major vault Proteins 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 210000005105 peripheral blood lymphocyte Anatomy 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 230000000241 respiratory effect Effects 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 238000002741 site-directed mutagenesis Methods 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000000527 sonication Methods 0.000 description 2
- 229960005202 streptokinase Drugs 0.000 description 2
- 239000013595 supernatant sample Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- GETQZCLCWQTVFV-UHFFFAOYSA-N trimethylamine Chemical compound CN(C)C GETQZCLCWQTVFV-UHFFFAOYSA-N 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- PJRSUKFWFKUDTH-JWDJOUOUSA-N (2s)-6-amino-2-[[2-[[(2s)-2-[[(2s,3s)-2-[[(2s)-2-[[2-[[(2s)-2-[[(2s)-6-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[(2-aminoacetyl)amino]-4-methylsulfanylbutanoyl]amino]propanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]propanoyl]amino]acetyl]amino]propanoyl Chemical compound CSCC[C@H](NC(=O)CN)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(N)=O PJRSUKFWFKUDTH-JWDJOUOUSA-N 0.000 description 1
- YHQZWWDVLJPRIF-JLHRHDQISA-N (4R)-4-[[(2S,3R)-2-[acetyl-[(3R,4R,5S,6R)-3-amino-4-[(1R)-1-carboxyethoxy]-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]amino]-3-hydroxybutanoyl]amino]-5-amino-5-oxopentanoic acid Chemical compound C(C)(=O)N([C@@H]([C@H](O)C)C(=O)N[C@H](CCC(=O)O)C(N)=O)C1[C@H](N)[C@@H](O[C@@H](C(=O)O)C)[C@H](O)[C@H](O1)CO YHQZWWDVLJPRIF-JLHRHDQISA-N 0.000 description 1
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- NMIZONYLXCOHEF-UHFFFAOYSA-N 1h-imidazole-2-carboxamide Chemical compound NC(=O)C1=NC=CN1 NMIZONYLXCOHEF-UHFFFAOYSA-N 0.000 description 1
- MIJDSYMOBYNHOT-UHFFFAOYSA-N 2-(ethylamino)ethanol Chemical compound CCNCCO MIJDSYMOBYNHOT-UHFFFAOYSA-N 0.000 description 1
- KISWVXRQTGLFGD-UHFFFAOYSA-N 2-[[2-[[6-amino-2-[[2-[[2-[[5-amino-2-[[2-[[1-[2-[[6-amino-2-[(2,5-diamino-5-oxopentanoyl)amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]-5-(diaminomethylideneamino)p Chemical compound C1CCN(C(=O)C(CCCN=C(N)N)NC(=O)C(CCCCN)NC(=O)C(N)CCC(N)=O)C1C(=O)NC(CO)C(=O)NC(CCC(N)=O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(C(=O)NC(CC(C)C)C(O)=O)CC1=CC=C(O)C=C1 KISWVXRQTGLFGD-UHFFFAOYSA-N 0.000 description 1
- 101100220718 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) cipA gene Proteins 0.000 description 1
- OGSPWJRAVKPPFI-UHFFFAOYSA-N Alendronic Acid Chemical compound NCCCC(O)(P(O)(O)=O)P(O)(O)=O OGSPWJRAVKPPFI-UHFFFAOYSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 229940122450 Altered peptide ligand Drugs 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- APKFDSVGJQXUKY-KKGHZKTASA-N Amphotericin-B Natural products O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1C=CC=CC=CC=CC=CC=CC=C[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-KKGHZKTASA-N 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 208000032467 Aplastic anaemia Diseases 0.000 description 1
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 101100446590 Arabidopsis thaliana FIM5 gene Proteins 0.000 description 1
- 241000712891 Arenavirus Species 0.000 description 1
- 206010003399 Arthropod bite Diseases 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 102100022717 Atypical chemokine receptor 1 Human genes 0.000 description 1
- 208000032116 Autoimmune Experimental Encephalomyelitis Diseases 0.000 description 1
- 208000004736 B-Cell Leukemia Diseases 0.000 description 1
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 241000304886 Bacilli Species 0.000 description 1
- 101100399280 Bacillus subtilis (strain 168) licH gene Proteins 0.000 description 1
- 229920002749 Bacterial cellulose Polymers 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 208000014644 Brain disease Diseases 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000282461 Canis lupus Species 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108010039939 Cell Wall Skeleton Proteins 0.000 description 1
- 229930186147 Cephalosporin Natural products 0.000 description 1
- 241000242722 Cestoda Species 0.000 description 1
- 101710091342 Chemotactic peptide Proteins 0.000 description 1
- 241000498849 Chlamydiales Species 0.000 description 1
- LIRCDOVJWUGTMW-ZWNOBZJWSA-N Chloramphenicol succinate Chemical compound OC(=O)CCC(=O)OC[C@@H](NC(=O)C(Cl)Cl)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 LIRCDOVJWUGTMW-ZWNOBZJWSA-N 0.000 description 1
- 206010008909 Chronic Hepatitis Diseases 0.000 description 1
- 108090000317 Chymotrypsin Proteins 0.000 description 1
- 108010038061 Chymotrypsinogen Proteins 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 206010010741 Conjunctivitis Diseases 0.000 description 1
- 101710139375 Corneodesmosin Proteins 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- 241000557626 Corvus corax Species 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- 240000005109 Cryptomeria japonica Species 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 206010011891 Deafness neurosensory Diseases 0.000 description 1
- 241000725619 Dengue virus Species 0.000 description 1
- 206010012438 Dermatitis atopic Diseases 0.000 description 1
- 208000019872 Drug Eruptions Diseases 0.000 description 1
- 208000003556 Dry Eye Syndromes Diseases 0.000 description 1
- 206010013774 Dry eye Diseases 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 208000032274 Encephalopathy Diseases 0.000 description 1
- 101001095863 Enterobacteria phage T4 RNA ligase 1 Proteins 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 101710126487 Envelope glycoprotein B Proteins 0.000 description 1
- 101710204837 Envelope small membrane protein Proteins 0.000 description 1
- 101100113310 Escherichia coli (strain K12) chbR gene Proteins 0.000 description 1
- 101001065501 Escherichia phage MS2 Lysis protein Proteins 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 101150106011 FIM2 gene Proteins 0.000 description 1
- 101150048576 FIM3 gene Proteins 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 101710154643 Filamentous hemagglutinin Proteins 0.000 description 1
- 101001070329 Geobacillus stearothermophilus 50S ribosomal protein L18 Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000008214 Glutamate decarboxylase Human genes 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 229930186217 Glycolipid Natural products 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 1
- 208000003084 Graves Ophthalmopathy Diseases 0.000 description 1
- 108010051696 Growth Hormone Proteins 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 206010019755 Hepatitis chronic active Diseases 0.000 description 1
- 206010019799 Hepatitis viral Diseases 0.000 description 1
- 102000007625 Hirudins Human genes 0.000 description 1
- 108010007267 Hirudins Proteins 0.000 description 1
- 102100034523 Histone H4 Human genes 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 1
- 101000678879 Homo sapiens Atypical chemokine receptor 1 Proteins 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000972485 Homo sapiens Lupus La protein Proteins 0.000 description 1
- 101001094545 Homo sapiens Retrotransposon-like protein 1 Proteins 0.000 description 1
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 1
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 1
- 108010003272 Hyaluronate lyase Proteins 0.000 description 1
- 102000001974 Hyaluronidases Human genes 0.000 description 1
- 241001600072 Hydroides Species 0.000 description 1
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 1
- 101150039708 IL15 gene Proteins 0.000 description 1
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108010007403 Immediate-Early Proteins Proteins 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102100034349 Integrase Human genes 0.000 description 1
- 102100034353 Integrase Human genes 0.000 description 1
- 208000029523 Interstitial Lung disease Diseases 0.000 description 1
- 208000003456 Juvenile Arthritis Diseases 0.000 description 1
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 1
- 208000009319 Keratoconjunctivitis Sicca Diseases 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 229940127171 LMB-2 Drugs 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 241000222732 Leishmania major Species 0.000 description 1
- 206010024229 Leprosy Diseases 0.000 description 1
- OJMMVQQUTAEWLP-UHFFFAOYSA-N Lincomycin Natural products CN1CC(CCC)CC1C(=O)NC(C(C)O)C1C(O)C(O)C(O)C(SC)O1 OJMMVQQUTAEWLP-UHFFFAOYSA-N 0.000 description 1
- 241000209082 Lolium Species 0.000 description 1
- 102100022742 Lupus La protein Human genes 0.000 description 1
- 102000009151 Luteinizing Hormone Human genes 0.000 description 1
- 108010073521 Luteinizing Hormone Proteins 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000000440 Melanoma-associated antigen Human genes 0.000 description 1
- 108050008953 Melanoma-associated antigen Proteins 0.000 description 1
- 108010057081 Merozoite Surface Protein 1 Proteins 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 108010008707 Mucin-1 Proteins 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 102100034263 Mucin-2 Human genes 0.000 description 1
- 108010008705 Mucin-2 Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 102000047918 Myelin Basic Human genes 0.000 description 1
- 102000055324 Myelin Proteolipid Human genes 0.000 description 1
- 101710107068 Myelin basic protein Proteins 0.000 description 1
- 101710094913 Myelin proteolipid protein Proteins 0.000 description 1
- 108700015872 N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine Proteins 0.000 description 1
- 108700020354 N-acetylmuramyl-threonyl-isoglutamine Proteins 0.000 description 1
- 241001644525 Nastus productus Species 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 241000244206 Nematoda Species 0.000 description 1
- 108010006232 Neuraminidase Proteins 0.000 description 1
- 102000005348 Neuraminidase Human genes 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 102000011931 Nucleoproteins Human genes 0.000 description 1
- 108010061100 Nucleoproteins Proteins 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 241000713112 Orthobunyavirus Species 0.000 description 1
- 102000004067 Osteocalcin Human genes 0.000 description 1
- 108090000573 Osteocalcin Proteins 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 102000036673 PRAME Human genes 0.000 description 1
- 108060006580 PRAME Proteins 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 108010019160 Pancreatin Proteins 0.000 description 1
- 108010067035 Pancrelipase Proteins 0.000 description 1
- 108090000445 Parathyroid hormone Proteins 0.000 description 1
- 102000003982 Parathyroid hormone Human genes 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 201000005702 Pertussis Diseases 0.000 description 1
- 108010081690 Pertussis Toxin Proteins 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 102000013566 Plasminogen Human genes 0.000 description 1
- 108010051456 Plasminogen Proteins 0.000 description 1
- 101710183389 Pneumolysin Proteins 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 206010065159 Polychondritis Diseases 0.000 description 1
- 108091036414 Polyinosinic:polycytidylic acid Proteins 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 206010036774 Proctitis Diseases 0.000 description 1
- 102000003946 Prolactin Human genes 0.000 description 1
- 108010057464 Prolactin Proteins 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 101710194807 Protective antigen Proteins 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 101710192141 Protein Nef Proteins 0.000 description 1
- 102000018819 Protein Translocation Systems Human genes 0.000 description 1
- 108010052646 Protein Translocation Systems Proteins 0.000 description 1
- 241000125945 Protoparvovirus Species 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 241000702263 Reovirus sp. Species 0.000 description 1
- 101710088839 Replication initiation protein Proteins 0.000 description 1
- 108010081734 Ribonucleoproteins Proteins 0.000 description 1
- 102000004389 Ribonucleoproteins Human genes 0.000 description 1
- 241000606651 Rickettsiales Species 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 206010039710 Scleroderma Diseases 0.000 description 1
- 208000009966 Sensorineural Hearing Loss Diseases 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 102100038803 Somatotropin Human genes 0.000 description 1
- 101001039853 Sonchus yellow net virus Matrix protein Proteins 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 206010042033 Stevens-Johnson syndrome Diseases 0.000 description 1
- 231100000168 Stevens-Johnson syndrome Toxicity 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 101710137302 Surface antigen S Proteins 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 208000000389 T-cell leukemia Diseases 0.000 description 1
- 210000000662 T-lymphocyte subset Anatomy 0.000 description 1
- 108010055044 Tetanus Toxin Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 1
- 108010034949 Thyroglobulin Proteins 0.000 description 1
- 102000009843 Thyroglobulin Human genes 0.000 description 1
- 241000130764 Tinea Species 0.000 description 1
- 208000002474 Tinea Diseases 0.000 description 1
- 241000223996 Toxoplasma Species 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 102000005937 Tropomyosin Human genes 0.000 description 1
- 108010030743 Tropomyosin Proteins 0.000 description 1
- 241000223109 Trypanosoma cruzi Species 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108010027252 Trypsinogen Proteins 0.000 description 1
- 102000018690 Trypsinogen Human genes 0.000 description 1
- 208000034784 Tularaemia Diseases 0.000 description 1
- 206010070517 Type 2 lepra reaction Diseases 0.000 description 1
- 241001467018 Typhis Species 0.000 description 1
- 102100039094 Tyrosinase Human genes 0.000 description 1
- 108060008724 Tyrosinase Proteins 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 1
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- 206010046914 Vaginal infection Diseases 0.000 description 1
- 201000008100 Vaginitis Diseases 0.000 description 1
- 108010059993 Vancomycin Proteins 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 108010059722 Viral Fusion Proteins Proteins 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 241000710886 West Nile virus Species 0.000 description 1
- 208000003152 Yellow Fever Diseases 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 241000193453 [Clostridium] cellulolyticum Species 0.000 description 1
- 241000193158 [Clostridium] josui Species 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 229940009456 adriamycin Drugs 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 229940062527 alendronate Drugs 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 229960004784 allergens Drugs 0.000 description 1
- 201000009961 allergic asthma Diseases 0.000 description 1
- 208000030961 allergic reaction Diseases 0.000 description 1
- NWMHDZMRVUOQGL-CZEIJOLGSA-N almurtide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)CO[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(C)=O)C=O NWMHDZMRVUOQGL-CZEIJOLGSA-N 0.000 description 1
- 208000004631 alopecia areata Diseases 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- DKNWSYNQZKUICI-UHFFFAOYSA-N amantadine Chemical compound C1C(C2)CC3CC2CC1(N)C3 DKNWSYNQZKUICI-UHFFFAOYSA-N 0.000 description 1
- 229960003805 amantadine Drugs 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229940126575 aminoglycoside Drugs 0.000 description 1
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 1
- 229960003942 amphotericin b Drugs 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000001147 anti-toxic effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 229960005475 antiinfective agent Drugs 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 208000002399 aphthous stomatitis Diseases 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 201000008937 atopic dermatitis Diseases 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 230000006472 autoimmune response Effects 0.000 description 1
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 1
- 201000004982 autoimmune uveitis Diseases 0.000 description 1
- 239000005016 bacterial cellulose Substances 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000002146 bilateral effect Effects 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 208000020670 canker sore Diseases 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 101150072516 cbhA gene Proteins 0.000 description 1
- 101150072511 celD gene Proteins 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 239000002458 cell surface marker Substances 0.000 description 1
- 210000004520 cell wall skeleton Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 229940124587 cephalosporin Drugs 0.000 description 1
- 150000001780 cephalosporins Chemical class 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 229960002579 chloramphenicol sodium succinate Drugs 0.000 description 1
- 208000019069 chronic childhood arthritis Diseases 0.000 description 1
- 229960002376 chymotrypsin Drugs 0.000 description 1
- 229960002227 clindamycin Drugs 0.000 description 1
- KDLRVYVGXIQJDK-AWPVFWJPSA-N clindamycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@H](C)Cl)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 KDLRVYVGXIQJDK-AWPVFWJPSA-N 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 230000000536 complexating effect Effects 0.000 description 1
- 208000004921 cutaneous lupus erythematosus Diseases 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 108010057085 cytokine receptors Proteins 0.000 description 1
- 102000003675 cytokine receptors Human genes 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 238000005034 decoration Methods 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 229960001259 diclofenac Drugs 0.000 description 1
- DCOPUUMXTXDBNB-UHFFFAOYSA-N diclofenac Chemical compound OC(=O)CC1=CC=CC=C1NC1=C(Cl)C=CC=C1Cl DCOPUUMXTXDBNB-UHFFFAOYSA-N 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- PSLWZOIUBRXAQW-UHFFFAOYSA-M dimethyl(dioctadecyl)azanium;bromide Chemical compound [Br-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CCCCCCCCCCCCCCCCCC PSLWZOIUBRXAQW-UHFFFAOYSA-M 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 230000006334 disulfide bridging Effects 0.000 description 1
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000000428 dust Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 108010078428 env Gene Products Proteins 0.000 description 1
- 108700004025 env Genes Proteins 0.000 description 1
- 229960003276 erythromycin Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 210000000887 face Anatomy 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 230000003325 follicular Effects 0.000 description 1
- 108700004026 gag Genes Proteins 0.000 description 1
- 210000000973 gametocyte Anatomy 0.000 description 1
- 150000002270 gangliosides Chemical class 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 108010008486 gp100 Melanoma Antigen Proteins 0.000 description 1
- 102000007192 gp100 Melanoma Antigen Human genes 0.000 description 1
- 108010072094 gp100(280-288) melanoma antigen peptide Proteins 0.000 description 1
- 229940046528 grass pollen Drugs 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002216 heart Anatomy 0.000 description 1
- 229940037467 helicobacter pylori Drugs 0.000 description 1
- 230000002008 hemorrhagic effect Effects 0.000 description 1
- 208000005252 hepatitis A Diseases 0.000 description 1
- 229940006607 hirudin Drugs 0.000 description 1
- WQPDUTSPKFMPDP-OUMQNGNKSA-N hirudin Chemical compound C([C@@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC(OS(O)(=O)=O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H]1NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H]2CSSC[C@@H](C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@H](C(NCC(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N2)=O)CSSC1)C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=2C=CC(O)=CC=2)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)[C@@H](C)O)CSSC1)C(C)C)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 WQPDUTSPKFMPDP-OUMQNGNKSA-N 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 102000007579 human kallikrein-related peptidase 3 Human genes 0.000 description 1
- 108010071652 human kallikrein-related peptidase 3 Proteins 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 229960002773 hyaluronidase Drugs 0.000 description 1
- 235000011167 hydrochloric acid Nutrition 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 229960001680 ibuprofen Drugs 0.000 description 1
- 229960004716 idoxuridine Drugs 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000037451 immune surveillance Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 230000001524 infective effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 238000011081 inoculation Methods 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 201000004614 iritis Diseases 0.000 description 1
- 229960003350 isoniazid Drugs 0.000 description 1
- QRXWMOHMRWLFEY-UHFFFAOYSA-N isoniazide Chemical compound NNC(=O)C1=CC=NC=C1 QRXWMOHMRWLFEY-UHFFFAOYSA-N 0.000 description 1
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 1
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 1
- 206010023332 keratitis Diseases 0.000 description 1
- 201000010666 keratoconjunctivitis Diseases 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 201000011486 lichen planus Diseases 0.000 description 1
- 229960005287 lincomycin Drugs 0.000 description 1
- OJMMVQQUTAEWLP-KIDUDLJLSA-N lincomycin Chemical compound CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@@H](C)O)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 OJMMVQQUTAEWLP-KIDUDLJLSA-N 0.000 description 1
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical compound O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 1
- 229920006008 lipopolysaccharide Polymers 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 229940040129 luteinizing hormone Drugs 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- ZLNQQNXFFQJAID-UHFFFAOYSA-L magnesium carbonate Chemical compound [Mg+2].[O-]C([O-])=O ZLNQQNXFFQJAID-UHFFFAOYSA-L 0.000 description 1
- 239000001095 magnesium carbonate Substances 0.000 description 1
- 229910000021 magnesium carbonate Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 201000004792 malaria Diseases 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 238000012737 microarray-based gene expression Methods 0.000 description 1
- 229960005225 mifamurtide Drugs 0.000 description 1
- JMUHBNWAORSSBD-WKYWBUFDSA-N mifamurtide Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCC)COP(O)(=O)OCCNC(=O)[C@H](C)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)OC(O)[C@@H]1NC(C)=O JMUHBNWAORSSBD-WKYWBUFDSA-N 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 229940072709 motrin Drugs 0.000 description 1
- 229940051875 mucins Drugs 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 238000012243 multiplex automated genomic engineering Methods 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 229940090008 naprosyn Drugs 0.000 description 1
- CMWTZPSULFXXJA-VIFPVBQESA-N naproxen Chemical compound C1=C([C@H](C)C(O)=O)C=CC2=CC(OC)=CC=C21 CMWTZPSULFXXJA-VIFPVBQESA-N 0.000 description 1
- 230000002956 necrotizing effect Effects 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 229960000988 nystatin Drugs 0.000 description 1
- VQOXZBDYSJBXMA-NQTDYLQESA-N nystatin A1 Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/CC/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 VQOXZBDYSJBXMA-NQTDYLQESA-N 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 229940126578 oral vaccine Drugs 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000011164 ossification Effects 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 229940055695 pancreatin Drugs 0.000 description 1
- 229960005489 paracetamol Drugs 0.000 description 1
- 239000000199 parathyroid hormone Substances 0.000 description 1
- 229960001319 parathyroid hormone Drugs 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 150000002960 penicillins Chemical class 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 108010021711 pertactin Proteins 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 150000003016 phosphoric acids Chemical class 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 108700004029 pol Genes Proteins 0.000 description 1
- 229920001515 polyalkylene glycol Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229940115272 polyinosinic:polycytidylic acid Drugs 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 229960005205 prednisolone Drugs 0.000 description 1
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 229940097325 prolactin Drugs 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 239000002510 pyrogen Substances 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 239000009342 ragweed pollen Substances 0.000 description 1
- 238000007670 refining Methods 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 238000012827 research and development Methods 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- JQXXHWHPUNPDRT-WLSIYKJHSA-N rifampicin Chemical compound O([C@](C1=O)(C)O/C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)\C=C\C=C(C)/C(=O)NC=2C(O)=C3C([O-])=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N1CC[NH+](C)CC1 JQXXHWHPUNPDRT-WLSIYKJHSA-N 0.000 description 1
- 229960001225 rifampicin Drugs 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 231100000879 sensorineural hearing loss Toxicity 0.000 description 1
- 208000023573 sensorineural hearing loss disease Diseases 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 210000003046 sporozoite Anatomy 0.000 description 1
- 229940031439 squalene Drugs 0.000 description 1
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 1
- 238000011301 standard therapy Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 150000003456 sulfonamides Chemical class 0.000 description 1
- 239000012134 supernatant fraction Substances 0.000 description 1
- 238000011477 surgical intervention Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960003604 testosterone Drugs 0.000 description 1
- 229940118376 tetanus toxin Drugs 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 229960002175 thyroglobulin Drugs 0.000 description 1
- 239000003104 tissue culture media Substances 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000007888 toxin activity Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- XETCRXVKJHBPMK-MJSODCSWSA-N trehalose 6,6'-dimycolate Chemical compound C([C@@H]1[C@H]([C@H](O)[C@@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](COC(=O)C(CCCCCCCCCCC3C(C3)CCCCCCCCCCCCCCCCCC)C(O)CCCCCCCCCCCCCCCCCCCCCCCCC)O2)O)O1)O)OC(=O)C(C(O)CCCCCCCCCCCCCCCCCCCCCCCCC)CCCCCCCCCCC1CC1CCCCCCCCCCCCCCCCCC XETCRXVKJHBPMK-MJSODCSWSA-N 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 229960001322 trypsin Drugs 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229960005356 urokinase Drugs 0.000 description 1
- 229960003165 vancomycin Drugs 0.000 description 1
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 1
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 1
- 229940118696 vibrio cholerae Drugs 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 201000001862 viral hepatitis Diseases 0.000 description 1
- 229960005080 warfarin Drugs 0.000 description 1
- PJVWKTKQMONHTI-UHFFFAOYSA-N warfarin Chemical compound OC=1C2=CC=CC=C2OC(=O)C=1C(CC(=O)C)C1=CC=CC=C1 PJVWKTKQMONHTI-UHFFFAOYSA-N 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/44—Antibodies bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
- C07H21/04—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with deoxyribosyl as saccharide radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/33—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Clostridium (G)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/54—F(ab')2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- the present invention relates in general to the field of novel vaccines, and more particularly, to the design, manufacture and use of multivariable antigens complexed with targeting humanized monoclonal antibodies.
- Protein engineering technology relating to monoclonal antibodies is highy advanced regarding humanization (i.e., rendering e.g., a rodent mAb sequence into a human mAb sequence while preserving specific antigen combining sites of the the original mAb) and production (typically secreted from mammalian cell lines).
- humanization i.e., rendering e.g., a rodent mAb sequence into a human mAb sequence while preserving specific antigen combining sites of the the original mAb
- production typically secreted from mammalian cell lines.
- engineered rAb-antigen fusion proteins typically with the antigen coding region placed in-frame with the C-terminal codon of the rAb heavy or H chain.
- a roadblock to this technology is the successful expression and production of fully functional rAb-antigen. In many, perhaps most, cases the desired antigen confounds secretion of the engineered rAb-antigen. Also, the likelihood of poor or null expression is increased if the
- the invention provides methods for the assembly of rAb antigen complexes in a controlled manner by simple mixing components and accomodates the ability to express and produce the rAb and antigen(s) in different expression—production systems that are best suited to the individual rAb and particular antigen.
- the invention demonstrates the novel application of the high affinity and high specificity cohesin-dockerin interaction to secreted mammalian expression systems, thus permitting the development of unique protein engineering formats and production of new protein tools for research and clinical application.
- the present invention uses the cohesin-dockerin protein domains and their surrounding linker.
- the invention permits the controlled assembly of recombinant monoclonal antibodies (rAbs) complexed to antigens, toxins, or cellular activating agents.
- rAbs monoclonal antibodies
- the invention has wide potential application in vaccination and cancer therapy. Also claimed are derivatives of this technology that permit the production of novel proteins with specific affinities for other proteins.
- the invention is based on particular components of the well studied bacterial cellulose degrading protein complex called the cellulosome. Specifically, two protein domains (cohesin and dockerin) and natural protein linker sequences are utilized via the invention in novel contexts and applications.
- the present invention is based on the discovery that particular cohesin and dockerin domains can be sucessfully and efficiently secreted from mammalian cells as fusion proteins while maintaining the specific and high affinity cohesin-dockerin protein-protein interaction. While the extensive cohesin-dockerin literature teaches the expectation that such fusion proteins should have this functionality, it does not describe production of such fusion proteins in mammalian secretion systems. The state of scientific knowledge does not allow the prediction of the discovery since the rules (other than features such as signal peptide) for successful secretion are not fully established. Furthermore, the cohesin linker regions are known to be glycosylated in their native bacteria, and the cohesin and dockerin domains contain predicted glycosylation sites. While this may actually favor secretion from mammalian cells, it is unclear if ‘unnatural’ glyosylation will perturb the cohesis-dockerin interaction.
- the invention includes the use of all cohesin-dockerin sequences from diverse cellulose degrading microbes, but describes the application of specific cohesin and dockerin and linker sequences from the microbe Clostridium thermocellum.
- the sequence described herein encodes the H chain of a human IgG4 linked at the C-terminal codon to a Clostridium thermocellum dockerin sequence (called rAb.doc).
- rAb.doc Clostridium thermocellum dockerin sequence
- Other embodiments of rAb.doc proteins are described similarly with examples that are engineered by simply transferring the dockerin coding region as a DNA fragment to vectors encoding the different H chain entities.
- the present invention includes a modular rAb carrier that includes an antigen-specific binding domain linked to one or more antigen carrier domains and one half of a cohesin-dockerin binding pair.
- the antigen-specific binding domain may be at least a portion of an antibody and the antibody is a fusion protein with and the binding pair in a fusion protein with one half of a cohesin-dockerin binding pair.
- the rAb may also include a complementary half of the cohesin-dockerin binding pair bound to an antigen that forms a complex with the modular rAb carrier.
- the complementary half of the cohesin-dockerin binding pair may itself be a fusion protein with the antigen carried as part of the complex (modular rAb carrier (cohesin/dockerin) antigen complex).
- antigen specific domain include a full length antibody, an antibody variable region domain, an Fab fragment, a Fab′ fragment, an F(ab) 2 fragment, and Fv fragment, and Fabc fragment and/or a Fab fragment with portions of the Fc domain.
- Non limiting examples of sources for the cohesin-dockerin binding pair include Clostridium thermocellum, Clostridium josui, Clostridium cellulolyticum and Bacteroides cellulosolvens and combinations thereof.
- Non-limiting examples for targeting by the antigen-specific binding domain include: cell surface marker selected from MHC class I, MHC class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD 19, CD20, CD29, CD31, CD40,CD43, CD44, CD45, CD54, CD56, CD57, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40, BDCA-2, MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1, B7-2, IFN- ⁇ receptor and IL-2 receptor, ICAM-1, Fc ⁇ receptor or other receptor relatively specifically expressed by antigen presenting cells.
- cell surface marker selected from MHC class I, MHC class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD 19, CD20, CD29, CD31, CD40,CD43, CD44, CD45, CD54,
- the rAb of the present invention may also includes combinations of the domains that are defined as: an rAb.Doc; an rAb.Coh; an rAb.(Coh) x ; an rAb.(Doc) x ; an rAb.(Coh.Doc) x ; or an rAb.(Coh) x (Doc) x ; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more.
- Examples of the modular rAb carrier in a complex include:
- the present invention also include a vaccine of a modular rAb carrier that includes an antigen specific domain linked to one or more domains comprising one half of the cohesin-dockerin binding pair bound to a complementary half of the cohesin-dockerin binding pair bound to an antigen.
- Non-limiting examples for targeting the rAb include immune cell surface protein selected from MHC class I, MHC class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD 19, CD20, CD29, CD31, CD40,CD43, CD44,CD45, CD54, CD56, CD57, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40, BDCA-2, MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1, B7-2, IFN- ⁇ receptor and IL-2 receptor, ICAM-1, Fc ⁇ receptor or other receptor relatively specifically expressed by antigen presenting cells.
- immune cell surface protein selected from MHC class I, MHC class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD 19, CD20, CD29, CD31, CD40,CD43, CD44,CD45, CD54, CD56,
- Targets for vaccination with the rAb antigen carrier include, e.g., a bacterial, viral, fungal, protozoan or cancer protein and fragments thereof.
- the vaccine of claim 11 wherein the modular rAb carrier is further defined: an rAb.Doc:Coh.antigen; an rAb.Coh:Doc.antigen; an rAb.(Coh) x :(Doc.antigen) x ; an rAb.(Doc) x :(Coh.antigen) x ; an rAb.(Coh.Doc) x :(Doc.antigen 1 )(Coh.antigen 2 ); or an rAb.(Coh) x (Doc) x :(Doc.antigen 1 ) x (Coh.antigen 2 ) x ; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- the present invention also includes an isolated nucleic acid comprising a coding segment for a target-specific domain and one or more domains and one half of a cohesin-dockerin binding pair.
- the target may be an antigen and the target specific domain may encode at least a portion of an antibody.
- the one or more domains can encode one or more cohesin domains, one or more dockerin domains or a combination of one or more cohesin and dockerin domains.
- the rAb is further defined as: an rAb.Doc; an rAb.Coh; an rAb.(Coh) x ; an rAb.(Doc) x ; an rAb.(Coh.Doc) x ; or an rAb.(Coh) x (Doc) x ; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- the present invention also includes a vector that includes a nucleic acid encoding an antigen specific domain and one or more domains that comprise one half of a cohesin-dockerin binding pair, a one half of a cohesin-dockerin binding pair with a protein molecule to be carried and combinations thereof.
- the one half of a cohesin-dockerin binding pair, a one half of a cohesin-dockerin binding pair with a protein molecule to be carried and combinations thereof are under the control of the same promoter, different promoters, transcribed in-line, transcribed in opposite directions.
- the present invention also includes a host cell comprising a vector comprising a nucleic acid encoding an antigen specific domain and one or more domains and one half of a cohesin-dockerin binding pair.
- a method of making a modular rAb carrier by combining an antigen specific domain linked to one or more domains of one half of a cohesin-dockerin binding pair is further defined as: an rAb.Doc; an rAb.Coh; an rAb.(Coh) x ; an rAb.(Doc) x ; an rAb.(Coh.Doc) x ; or an rAb.(Coh) x (Doc) x ; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- Examples of the rAb is complexed with a complementary half of a cohesion:dokerin pair bound to an antigen and is selected from: an rAb.Doc:Coh.antigen; an rAb.Coh:Doc.antigen; an rAb.(Coh) x :(Doc.antigen) x ; an rAb.(Doc) x :(Coh.antigen) x ; an rAb.(Coh.Doc) x :(Doc.antigen 1 )(Coh.antigen 2 ); or an rAb.(Coh) x (Doc) x :(Doc.antigen 1 ) x (Coh.antigen 2 ) x ; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- the present invention may also be an immunotoxin that includes an rAb.Doc:Coh.toxin self-assembled conjugate, wherein the rAb is specific for a cell target.
- toxins include a radioactive isotope, metal, enzyme, botulin, tetanus, ricin, cholera, diphtheria, aflatoxins, perfringens toxin, mycotoxins, shigatoxin, staphylococcal enterotoxin B, T2, seguitoxin, saxitoxin, abrin, cyanoginosin, alphatoxin, tetrodotoxin, aconotoxin, snake venom and spider venom.
- Cell targets for the immunotoxin include diseased or infected cells.
- diseased cells for targeting include cancer cell for, e.g., hematological cancers such as leukemias and lymphomas, neurological tumors such as astrocytomas or glioblastomas, melanoma, breast cancer, lung cancer, head and neck cancer, gastrointestinal tumors such as gastric or colon cancer, liver cancer, pancreatic cancer, genitourinary tumors such cervix, uterus, ovarian cancer, vaginal cancer, testicular cancer, prostate cancer or penile cancer, bone tumors, vascular tumors, or cancers of the lip, nasopharynx, pharynx and oral cavity, esophagus, rectum, gall bladder, biliary tree, larynx, lung and bronchus, bladder, kidney, brain and other parts of the nervous system, thyroid, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myelo
- the present invention also includes a method for protein purification by separating a cohesin or dockerin fusion protein by interacting the fusion protein with a rAb that is conjugated to the complementary cohesin or dockerin bound to a substrate.
- the present invention may also use the cohesin as a fusion partner for toxins for conferring beneficial biochemical properties favoring ready purification of active cohesin.toxin fusion protein.
- the present invention may also use the anti-DC rAb.Doc to target DC for therapeutic applications where ablating DC. Therapeutic applications include, e.g., transplantation, autoimmune disease, infectious disease or cancer.
- the invention also includes an anti-DC-SIGN/L antibody provided in an amount that is sufficient to enhance the survival of dendritic cells, wherein the antibody matures and activates the dendritic cells for immunization.
- the antibody may target cells in vivo, e.g., dendritic cells as an adjuvant in vaccines.
- rAb 1 .Doc:Coh.rAb 2 a bivalent and multivalent self-assembled conjugates as therapeutic, diagnostic, and industrial agents.
- the invention is a bivalent and multivalent (rAb.Doc:Coh.cytokine), (rAb.Coh:Doc.cytokine) or (cytokine 1 .Coh:cytokine 2 .Doc) self-assembled conjugates as therapeutic, cell proliferation or maturing agents.
- the modular rAbs carrier may be made by method that includes screening one or more multivalent rAb and/or rAb.cytokine and/or cytokine.cytokine combinations that are capable of specifically binding to a target cell and delivering the cytokine such that it exerts its effect on the target cell.
- Cytokines for use with the present invention include: interleukins, transforming growth factors (TGFs), fibroblast growth factors (FGFs), platelet derived growth factors (PDGFs), epidermal growth factors (EGFs), connective tissue activated peptides (CTAPs), osteogenic factors, and biologically active analogs, fragments, and derivatives of such growth factors, B/T-cell differentiation factors, B/T-cell growth factors, mitogenic cytokines, chemotactic cytokines, colony stimulating factors, angiogenesis factors, IFN- ⁇ , IFN- ⁇ , IFN- ⁇ , IL1, IL2, IL3, IL4, IL5, IL6, IL7, IL8, IL9, IL10, IL11, IL12, IL13, IL14, Il15, IL16, IL17, IL 18, etc., leptin, myostatin, macrophage stimulating protein, platelet-derived growth factor, TNF- ⁇ , TNF- ⁇ , NGF, CD
- FIG. 1 compares the prior art (top portion) with an example of the multiple antigens targeted in a complex simultaneously with the same engineered humanized mAb (MATCHMAB) (bottom portion).
- MATCHMAB engineered humanized mAb
- FIG. 2 shows the use of the present invention to form Bi-specific mAbs.
- FIG. 3 shows Protein G affinity purified secreted rAb proteins analyzed by reducing SDS.PAGE and Coomassie Brilliant Blue staining. Lanes are from left to right.
- FIGS. 4A and 4B show the measurement by anti-human IgFc ELISA of levels of secretion of various rAb.fusion proteins.
- FIG. 5 shows the measurement by anti-human IgFc ELISA (HRP activity) and LOX-1.alkaline phoshatase binding (AP activity) of secreted anti-LOX1 — 15C4 rAb.(blue symbols) and anti-LOX1 — 15C4.doc rAb (red symbols) proteins.
- FIG. 6 shows that when co-transfected with a mIgG kappa expression plasmid, rAB-pCMV(mIgG2bH-Dockerin) plasmid directs the efficient secretion of rAB-mIgG2b.Dockerin fusion protein.
- FIGS. 7A and 7B show that the secreted coh.alkaline phosphatase (coh.AP) but not AP binds efficiently and specifically to rAb.Doc immobilized on plastic.
- FIGS. 8A and 8B shows various dilutions of a supernatant containing secreted G.AP bound to immobilized mIgG2a and mIgG2b, but not rAb.doc, while coh.AP bound rAb.doc specifically.
- FIG. 9 shows the differential stability of complexes between a fixed amount of proG.AP or coh.AP or coh2.AP (0.1 ug) and immobilized mIgG2b or rAb.doc (0.25 ug) assembled by incubation for 1 hr in a micro-titre plate.
- FIG. 10 shows the differential stability in human serum of complexes between a fixed amount of proG.AP or coh.AP (0.1 ug) and immobilized mIgG2b or rAb.doc (0.25 ug) were assembled by incubation for 1 hr in a micro-titre plate.
- FIG. 11 is a gel that shows the reduced vs. non-reduced SDS.PAGE analysis of rAb.doc:Coh2.AP complexes produced by sequential application of rAb.doc supernatant and coh.AP supernatant to the same protein G affinity column.
- FIG. 12 is a non-reduced SDS.PAGE analysis of rAb.doc:Coh.Flu HA5-1 complexes produced by sequential application of rAb.doc supernatant and coh.Flu HA5-1 supernatant to the same protein G affinity column.
- FIG. 13 shows that anti-DC_rAb.doc:coh.Flu M1 complex formed by mixing the individual purified components was effective in vitro in expanding Flu M1-specific T cells.
- FIG. 14 shows that Anti-DC_rAb.doc:coh.Flu M1 but not mIgG2b.doc:coh.Flu M1 complexes formed by mixing the individual purified components was effective in vitro in expanding Flu M1-specific T cells.
- FIG. 15 shows CD34+ human DC were sorted into CD1a+ and CD14+ subtypes and cultured with and without 3 nM Anti-DC_rAb.Flu M1 PEP or Anti-DC_rAb.
- FIG. 16 shows E. coli harboring expression plasmids directing the synthesis of coh.pep proteins were grown and induced for specific protein production. Cells were harvested and broken by sonication.
- FIG. 17 shows that the DCIR.Doc rAb alone had no effect upon the survival of DCs, but DC-SIGN/L.Doc rAb ehnaces their survival.
- FIG. 18 shows that Coh.PE38 alone slightly increase the number of 7-AAD scored apoptotic cells (from 22.1-29.8%), but when linked to DCIR or DC-SIGN/L.Doc rAbs, Coh.PE38 greatly enhanced the number of 7-AAD scored apoptotic cells.
- FIG. 19 shows the expression of anti-DC-SIGN/L and Anti-DC-ASPGR rAb.Coh and rAb.Doc were efficiently secreted.
- FIG. 20 shows the effect of IL-21 and Coh.IL-21 on the proliferation of human B cells.
- protein engineering technology enables the ready and controlled addition of an antigen (or different antigens to one of the chains) of a recombinant mAb (H or L, usually the C-terminus of H is often used). If different antigens or different antigen sets need to be linked to the mAb, then the mAb needs to be re-engineered, expressed, and purified as a different entity.
- the present invention provides for the complexing of multiple antigens or proteins (engineered, expressed, and purified independently from the primary mAb) in a controlled, multivariable fashion, to one single primary recombinant mAb.
- multiple antigens or proteins engineered, expressed, and purified independently from the primary mAb
- present invention provides for addition to the primary mAb of multiple combinations, in fixed equimolar ratios and locations, of separately engineered proteins.
- the term “modular rAb carrier” is used to describe a recombinant antibody system that has been engineered to provide the controlled modular addition of diverse antigens, activating proteins, or other antibodies to a single recombinant monoclonal antibody (mAb).
- the rAb may be a monoclonal antibody made using standard hybridoma techniques, recombinant antibody display, humanized monoclonal antibodies and the like.
- the modular rAb carrier can be used to, e.g., target (via one primary recombinant antibody against an internalizing receptor, e.g., a human dendritic cell receptor) multiple antigens and/or antigens and an activating cytokine to dendritic cells (DC).
- the modular rAb carrier may also be used to join two different recombinant mAbs end-to-end in a controlled and defined manner.
- the antigen binding portion of the “modular rAb carrier” may be one or more variable domains, one or more variable and the first constant domain, an Fab fragment, a Fab' fragment, an F(ab) 2 fragment, and Fv fragment, and Fabc fragment and/or a Fab fragment with portions of the Fc domain to which the cognate modular binding portions are added to the amino acid sequence and/or bound.
- the antibody for use in the modular rAb carrier can be of any isotype or class, subclass or from any source (animal and/or recombinant).
- the modular rAb carrier is engineered to have one or more modular cohesin-dockerin protein domains for making specific and defined protein complexes in the context of engineered recombinant mAbs.
- the mAb is a portion of a fusion protein that includes one or more modular cohesin-dockerin protein domains carboxy from the antigen binding domains of the mAb.
- the cohesin-dockerin protein domains may even be attached post-translationally, e.g., by using chemical cross-linkers and/or disulfide bonding.
- the modular rAb carrier will be used to carry a separate molecule, e.g., a peptide, protein, lipid, carbohydrate, nucleic acid (oligonucleotide, aptamer, vector with or without base or backbone modifications) or combinations thereof by binding that separate molecule to the complementary half of the cohesion:dockerin pair.
- a separate molecule e.g., a peptide, protein, lipid, carbohydrate, nucleic acid (oligonucleotide, aptamer, vector with or without base or backbone modifications) or combinations thereof by binding that separate molecule to the complementary half of the cohesion:dockerin pair.
- the dockerin or cohesin made be made into a fusion protein or chemically bound to an antigen, a peptide, a protein, a toxin, a cytokine, an enzyme, a structural protein, an extracellular matrix protein, another antibody, a cell or fragments thereof.
- the modular rAb carrier may have one or more cohesin, dockerin or both cohesin and dockerin domains that allow the formation of a complex with one or more complementary cohesin/dockerin-molecules for delivery via the antigen recognition domain of the modular rAb carrier.
- antigen refers to a molecule that can initiate a humoral and/or cellular immune response in a recipient of the antigen.
- Antigen may be used in two different contexts with the present invention: as a target for the antibody or other antigen recognition domain of the rAb or as the molecule that is carried to and/or into a cell or target by the rAb as part of a dockerin/cohesin-molecule complement to the modular rAb carrier.
- the antigen is usually an agent that causes a disease for which a vaccination would be advantageous treatment.
- the peptide is often about 8 to about 25 amino acids.
- Antigens include any type of biologic molecule, including, for example, simple intermediary metabolites, sugars, lipids and hormones as well as macromolecules such as complex carbohydrates, phospholipids, nucleic acids and proteins.
- Common categories of antigens include, but are not limited to, viral antigens, bacterial antigens, fungal antigens, protozoal and other parasitic antigens, tumor antigens, antigens involved in autoimmune disease, allergy and graft rejection, and other miscellaneous antigens.
- the modular rAb carrier is able to carry any number of active agents, e.g., antibiotics, anti-infective agents, antiviral agents, anti-tumoral agents, antipyretics, analgesics, anti-inflammatory agents, therapeutic agents for osteoporosis, enzymes, cytokines, anticoagulants, polysaccharides, collagen, cells, and combinations of two or more of the foregoing active agents.
- active agents e.g., antibiotics, anti-infective agents, antiviral agents, anti-tumoral agents, antipyretics, analgesics, anti-inflammatory agents, therapeutic agents for osteoporosis, enzymes, cytokines, anticoagulants, polysaccharides, collagen, cells, and combinations of two or more of the foregoing active agents.
- antibiotics for delivery using the present invention include, without limitation, tetracycline, aminoglycosides, penicillins, cephalosporins, sulfonamide drugs, chloramphenicol sodium succinate, erythromycin, vancomycin, lincomycin, clindamycin, nystatin, amphotericin B, amantidine, idoxuridine, p-amino salicyclic acid, isoniazid, rifampin, antinomycin D, mithramycin, daunomycin, adriamycin, bleomycin, vinblastine, vincristine, procarbazine, imidazole carboxamide, and the like.
- anti-tumor agents for delivery using the present invention include, without limitation, doxorubicin, Daunorubicin, taxol, methotrexate, and the like.
- antipyretics and analgesics include aspirin, Motrin®, Ibuprofen®, naprosyn, acetaminophen, and the like.
- anti-inflammatory agents for delivery using the present invention include, without limitation, include NSAIDS, aspirin, steroids, dexamethasone, hydrocortisone, prednisolone, Diclofenac Na, and the like.
- therapeutic agents for treating osteoporosis and other factors acting on bone and skeleton include for delivery using the present invention include, without limitation, calcium, alendronate, bone GLa peptide, parathyroid hormone and its active fragments, histone H4-related bone formation and proliferation peptide and mutations, derivatives and analogs thereof.
- enzymes and enzyme cofactors for delivery using the present invention include, without limitation, pancrease, L-asparaginase, hyaluronidase, chymotrypsin, trypsin, tPA, streptokinase, urokinase, pancreatin, collagenase, trypsinogen, chymotrypsinogen, plasminogen, streptokinase, adenyl cyclase, superoxide dismutase (SOD), and the like.
- SOD superoxide dismutase
- cytokines for delivery using the present invention include, without limitation, interleukins, transforming growth factors (TGFs), fibroblast growth factors (FGFs), platelet derived growth factors (PDGFs), epidermal growth factors (EGFs), connective tissue activated peptides (CTAPs), osteogenic factors, and biologically active analogs, fragments, and derivatives of such growth factors.
- TGFs transforming growth factors
- FGFs fibroblast growth factors
- PDGFs platelet derived growth factors
- EGFs epidermal growth factors
- CRFs connective tissue activated peptides
- osteogenic factors and biologically active analogs, fragments, and derivatives of such growth factors.
- Cytokines may be B/T-cell differentiation factors, B/T-cell growth factors, mitogenic cytokines, chemotactic cytokines, colony stimulating factors, angiogenesis factors, IFN- ⁇ , IFN- ⁇ , IFN- ⁇ , IL1, IL2, IL3, IL4, IL5, IL6, IL7, IL8, IL9, IL10, IL11, IL12, IL13, IL14, IL15, IL16, IL17, IL18, etc., leptin, myostatin, macrophage stimulating protein, platelet-derived growth factor, TNF- ⁇ , TNF- ⁇ , NGF, CD40L, CD137L/4-1BBL, human lymphotoxin- ⁇ , G-CSF, M-CSF, GM-CSF, PDGF, IL-1 ⁇ , IL1- ⁇ , IP-10, PF4, GRO, 9E3, erythropoietin, endostatin, angiostatin, VE
- TGF transforming growth factor
- Other cytokines include members of the transforming growth factor (TGF) supergene family include the beta transforming growth factors (for example TGF- ⁇ 1, TGF- ⁇ 2, TGF- ⁇ 3); bone morphogenetic proteins (for example, BMP-1, BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP-7, BMP-8, BMP-9); heparin-binding growth factors (for example, fibroblast growth factor (FGF), epidermal growth factor (EGF), platelet-derived growth factor (PDGF), insulin-like growth factor (IGF)); Inhibins (for example, Inhibin A, Inhibin B); growth differentiating factors (for example, GDF-1); and Activins (for example, Activin A, Activin B, Activin AB).
- TGF transforming growth factor
- BMP-3 bone morphogenetic proteins
- BMP-5, BMP-6, BMP-7, BMP-8, BMP-9 heparin-bind
- growth factors for delivery using the present invention include, without limitation, growth factors that can be isolated from native or natural sources, such as from mammalian cells, or can be prepared synthetically, such as by recombinant DNA techniques or by various chemical processes.
- analogs, fragments, or derivatives of these factors can be used, provided that they exhibit at least some of the biological activity of the native molecule.
- analogs can be prepared by expression of genes altered by site-specific mutagenesis or other genetic engineering techniques.
- anticoagulants for delivery using the present invention include, without limitation, include warfarin, heparin, Hirudin, and the like.
- factors acting on the immune system include for delivery using the present invention include, without limitation, factors which control inflammation and malignant neoplasms and factors which attack infective microorganisms, such as chemotactic peptides and bradykinins.
- viral antigens and/or viral antigenic targets include, but are not limited to, e.g., retroviral antigens such as retroviral antigens from the human immunodeficiency virus (HIV) antigens such as gene products of the gag, pol, and env genes, the Nef protein, reverse transcriptase, and other HIV components; hepatitis viral antigens such as the S, M, and L proteins of hepatitis B virus, the pre-S antigen of hepatitis B virus, and other hepatitis, e.g., hepatitis A, B, and C, viral components such as hepatitis C viral RNA; influenza viral antigens such as hemagglutinin and neuraminidase and other influenza viral components; measles viral antigens such as the measles virus fusion protein and other measles virus components; rubella viral antigens such as proteins E1 and E2 and other rubella virus components; rotaviral antigen
- Antigens and/or antigenic targets that may be delivered using the rAb-DC/DC-antigen vaccines of the present invention include genes encoding antigens such as viral antigens, bacterial antigens, fungal antigens or parasitic antigens.
- Viruses include picornavirus; coronavirus, togavirus, flavirvirus, rhabdovirus, paramyxovirus, orthomyxovirus, bunyavirus, arenavirus, reovirus, retrovirus, papilomavirus, parvovirus, herpesvirus, poxvirus, hepadnavirus, and spongiform virus.
- viral targets include influenza, herpes simplex virus 1 and 2, measles, dengue, smallpox, polio or HIV.
- Pathogens include trypanosomes, tapeworms, roundworms, helminthes, malaria.
- Tumor markers such as fetal antigen or prostate specific antigen, may be targeted in this manner.
- Other examples include: HIV env proteins and hepatitis B surface antigen.
- Administration of a vector according to the present invention for vaccination purposes would require that the vector-associated antigens be sufficiently non-immunogenic to enable long term expression of the transgene, for which a strong immune response would be desired.
- vaccination of an individual may only be required infrequently, such as yearly or biennially, and provide long term immunologic protection against the infectious agent.
- organisms, allergens and nucleic and amino sequences for use in vectors and ultimately as antigens with the present invention may be found in U.S. Pat. No. 6,541,011, relevant portions incorporated herein by reference, in particular, the tables that match organisms and specific sequences that may be used with the present invention.
- Bacterial antigens for use with the rAb vaccine disclosed herein include, but are not limited to, e.g., bacterial antigens such as pertussis toxin, filamentous hemagglutinin, pertactin, FIM2, FIM3, adenylate cyclase and other pertussis bacterial antigen components; diptheria bacterial antigens such as diptheria toxin or toxoid and other diptheria bacterial antigen components; tetanus bacterial antigens such as tetanus toxin or toxoid and other tetanus bacterial antigen components; streptococcal bacterial antigens such as M proteins and other streptococcal bacterial antigen components; gram-negative bacilli bacterial antigens such as lipopolysaccharides and other gram-negative bacterial antigen components, Mycobacterium tuberculosis bacterial antigens such as mycolic acid, heat shock protein
- Partial or whole pathogens may also be: haemophilus influenza; Plasmodium falciparum; neisseria meningitidis; streptococcus pneumoniae; neisseria gonorrhoeae; salmonella serotype typhi; shigella; vibrio cholerae; Dengue Fever; Encephalitides; Japanese Encephalitis; lyme disease; Yersinia pestis ; west nile virus; yellow fever; tularemia; hepatitis (viral; bacterial); RSV (respiratory syncytial virus); HPIV 1 and HPIV 3; adenovirus; small pox; allergies and cancers.
- Fungal antigens for use with compositions and methods of the invention include, but are not limited to, e.g., candida fungal antigen components; histoplasma fungal antigens such as heat shock protein 60 (HSP60) and other histoplasma fungal antigen components; cryptococcal fungal antigens such as capsular polysaccharides and other cryptococcal fungal antigen components; coccidiodes fungal antigens such as spherule antigens and other coccidiodes fungal antigen components; and tinea fungal antigens such as trichophytin and other coccidiodes fungal antigen components.
- candida fungal antigen components histoplasma fungal antigens such as heat shock protein 60 (HSP60) and other histoplasma fungal antigen components
- cryptococcal fungal antigens such as capsular polysaccharides and other cryptococcal fungal antigen components
- coccidiodes fungal antigens such as spherule antigen
- protozoal and other parasitic antigens include, but are not limited to, e.g., plasmodium falciparum antigens such as merozoite surface antigens, sporozoite surface antigens, circumsporozoite antigens, gametocyte/gamete surface antigens, blood-stage antigen pf 155/RESA and other plasmodial antigen components; toxoplasma antigens such as SAG-1, p30 and other toxoplasmal antigen components; schistosomae antigens such as glutathione-S-transferase, paramyosin, and other schistosomal antigen components; leishmania major and other leishmaniae antigens such as gp63, lipophosphoglycan and its associated protein and other leishmanial antigen components; and trypanosoma cruzi antigens such as the 75-77 kDa antigen, the 56 kDa antigen and other trypanosomal antigen
- Target antigens on immune cell surfaces that can be targeted using the antigen recognition site of the antibody portion of the rAb of the present invention will generally be selected based on a number of factors, including: likelihood of internalization, level of immune cell specificity, type of immune cell targeted, level of immune cell maturity and/or activation and the like.
- cell surface markers for dendritic cells include, but are not limited to, MHC class I, MHC Class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD19, CD20, CD29, CD31, CD40, CD43, CD44, CD45, CD54, CD56, CD57, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40, BDCA-2, MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1, B7-2, IFN-y receptor and IL-2 receptor, ICAM-1, Fc ⁇ receptor or other receptor relatively specifically expressed by antigen presenting cells.
- cell surface markers for antigen presenting cells include, but are not limited to, MHC class I, MHC Class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD19, CD20, CD29, CD31, CD40,CD43, CD44, CD45, CD54, CD56, CD57, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40, BDCA-2, MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1, B7-2, IFN- ⁇ receptor and IL-2 receptor, ICAM-1, Fc ⁇ receptor or other receptor relatively specifically expressed by antigen presenting cells.
- cell surface markers for T cells include, but are not limited to, CD3, CD4, CD8, CD14, CD20, CD11b, CD16, CD45 and HLA-DR.
- Target antigens on cell surfaces for delivery includes those characteristic of tumor antigens typically will be derived from the cell surface, cytoplasm, nucleus, organelles and the like of cells of tumor tissue.
- tumor targets for the antibody portion of the present invention include, without limitation, hematological cancers such as leukemias and lymphomas, neurological tumors such as astrocytomas or glioblastomas, melanoma, breast cancer, lung cancer, head and neck cancer, gastrointestinal tumors such as gastric or colon cancer, liver cancer, pancreatic cancer, genitourinary tumors such cervix, uterus, ovarian cancer, vaginal cancer, testicular cancer, prostate cancer or penile cancer, bone tumors, vascular tumors, or cancers of the lip, nasopharynx, pharynx and oral cavity, esophagus, rectum, gall bladder, biliary tree, larynx, lung and bronchus, bladder, kidney, brain and other parts of the nervous system,
- antigens examples include tumor proteins, e.g., mutated oncogenes; viral proteins associated with tumors; and tumor mucins and glycolipids.
- the antigens may be viral proteins associated with tumors would be those from the classes of viruses noted above.
- Certain antigens may be characteristic of tumors (one subset being proteins not usually expressed by a tumor precursor cell), or may be a protein which is normally expressed in a tumor precursor cell, but having a mutation characteristic of a tumor.
- Other antigens include mutant variant(s) of the normal protein having an altered activity or subcellular distribution, e.g., mutations of genes giving rise to tumor antigens.
- tumor antigens include: CEA, prostate specific antigen (PSA), HER-2/neu, BAGE, GAGE, MAGE 1-4, 6 and 12, MUC (Mucin) (e.g., MUC-1, MUC-2, etc.), GM2 and GD2 gangliosides, ras, myc, tyrosinase, MART (melanoma antigen), Pmel 17 (gp100), GnT-V intron V sequence (N-acetylglucoaminyltransferase V intron V sequence), Prostate Ca psm, PRAME (melanoma antigen), ⁇ -catenin, MUM-1-B (melanoma ubiquitous mutated gene product), GAGE (melanoma antigen) 1, BAGE (melanoma antigen) 2-10, c-ERB2 (Her2/neu), EBNA (Epstein-Barr Virus nuclear antigen) 1-6, gp75, human papillo
- the immunogenic molecule can be an autoantigen involved in the initiation and/or propagation of an autoimmune disease, the pathology of which is largely due to the activity of antibodies specific for a molecule expressed by the relevant target organ, tissue, or cells, e.g., SLE or MG.
- a Th2-type immune response to the relevant autoantigen towards a cellular (i.e., a Th1-type) immune response.
- Autoantigens of interest include, without limitation: (a) with respect to SLE, the Smith protein, RNP ribonucleoprotein, and the SS-A and SS-B proteins; and (b) with respect to MG, the acetylcholine receptor.
- examples of other miscellaneous antigens involved in one or more types of autoimmune response include, e.g., endogenous hormones such as luteinizing hormone, follicular stimulating hormone, testosterone, growth hormone, prolactin, and other hormones.
- Antigens involved in autoimmune diseases, allergy, and graft rejection can be used in the compositions and methods of the invention.
- an antigen involved in any one or more of the following autoimmune diseases or disorders can be used in the present invention: diabetes, diabetes mellitus, arthritis (including rheumatoid arthritis, juvenile rheumatoid arthritis, osteoarthritis, psoriatic arthritis), multiple sclerosis, myasthenia gravis, systemic lupus erythematosis, autoimmune thyroiditis, dermatitis (including atopic dermatitis and eczematous dermatitis), psoriasis, Sjogren's Syndrome, including keratoconjunctivitis sicca secondary to Sjogren's Syndrome, alopecia areata, allergic responses due to arthropod bite reactions, Crohn's disease, aphthous ulcer, ulceris, conjunctivitis, keratoconjunctivitis, ulcerative colitis, asthma
- antigens involved in autoimmune disease include glutamic acid decarboxylase 65 (GAD 65), native DNA, myelin basic protein, myelin proteolipid protein, acetylcholine receptor components, thyroglobulin, and the thyroid stimulating hormone (TSH) receptor.
- GID 65 glutamic acid decarboxylase 65
- native DNA myelin basic protein
- myelin proteolipid protein acetylcholine receptor components
- thyroglobulin thyroid stimulating hormone
- antigens involved in allergy include pollen antigens such as Japanese cedar pollen antigens, ragweed pollen antigens, rye grass pollen antigens, animal derived antigens such as dust mite antigens and feline antigens, histocompatiblity antigens, and penicillin and other therapeutic drugs.
- antigens involved in graft rejection include antigenic components of the graft to be transplanted into the graft recipient such as heart, lung, liver, pancreas, kidney, and neural graft components.
- the antigen may be an altered peptide ligand useful in treating an autoimmune disease.
- epitope(s) refer to a peptide or protein antigen that includes a primary, secondary or tertiary structure similar to an epitope located within any of a number of pathogen polypeptides encoded by the pathogen DNA or RNA.
- the level of similarity will generally be to such a degree that monoclonal or polyclonal antibodies directed against such polypeptides will also bind to, react with, or otherwise recognize, the peptide or protein antigen.
- Various immunoassay methods may be employed in conjunction with such antibodies, such as, for example, Western blotting, ELISA, RIA, and the like, all of which are known to those of skill in the art.
- pathogen epitopes and/or their functional equivalents, suitable for use in vaccines is part of the present invention. Once isolated and identified, one may readily obtain functional equivalents. For example, one may employ the methods of Hopp, as taught in U.S. Pat. No. 4,554,101, incorporated herein by reference, which teaches the identification and preparation of epitopes from amino acid sequences on the basis of hydrophilicity. The methods described in several other papers, and software programs based thereon, can also be used to identify epitopic core sequences (see, for example, Jameson and Wolf, 1988; Wolf et al., 1988; U.S. Pat. No. 4,554,101). The amino acid sequence of these “epitopic core sequences” may then be readily incorporated' into peptides, either through the application of peptide synthesis or recombinant technology.
- promoter describes a control sequence that is a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors.
- the phrases “operatively positioned,” “operatively linked,” “under control,” and “under transcriptional control” mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence (i.e., ORF) to control transcriptional initiation and/or expression of that sequence.
- a promoter may or may not be used in conjunction with an “enhancer,” which refers to a cis-acting regulatory sequence involved in the, transcriptional activation of a nucleic acid sequence.
- an “enhancer” refers to a cis-acting regulatory sequence involved in the, transcriptional activation of a nucleic acid sequence.
- the terms “cell,” “cell line,” and “cell culture” may be used interchangeably. All of these terms also include their progeny, which is any and all subsequent generations, in vivo, ex vivo or in vitro. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations.
- “host cell” refers to a prokaryotic or eukaryotic cell, and it includes any transformable organism that is capable of expressing a heterologous gene encoded by a vector as delivered using the rAb protein vector of the present invention. A host cell can, and has been, used as a recipient for vectors.
- a host cell may be “transfected” or “transformed,” which refers to a process by which the exogenous nucleic acid expressing an antigen, as disclosed herein, is transferred or introduced into the host cell.
- a transformed cell includes the primary subject cell and its progeny.
- the preparation of vaccine compositions that includes the nucleic acids that encode antigens of the invention as the active ingredient, may be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to infection can also be prepared.
- the preparation may be emulsified, encapsulated in liposomes.
- the active immunogenic ingredients are often mixed with carriers which are pharmaceutically acceptable and compatible with the active ingredient.
- pharmaceutically acceptable carrier refers to a carrier that does not cause an allergic reaction or other untoward effect in subjects to whom it is administered.
- suitable pharmaceutically acceptable carriers include, for example, one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, or the like and combinations thereof.
- the vaccine can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and/or adjuvants which enhance the effectiveness of the vaccine.
- adjuvants examples include but are not limited to: aluminum hydroxide, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine, MTP-PE and RIBI, which contains three components extracted from bacteria, monophosporyl lipid A, trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2% squalene/Tween 80 emulsion.
- thr-MDP N-acetyl-muramyl-L-threonyl-D-isoglutamine
- MTP-PE N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine
- MTP-PE N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine
- adjuvants include DDA (dimethyldioctadecylammonium bromide), Freund's complete and incomplete adjuvants and QuilA.
- immune modulating substances such as lymphokines (e.g., IFN- ⁇ , IL-2 and IL-12) or synthetic IFN- ⁇ inducers such as poly I:C can be used in combination with adjuvants described herein.
- compositions may include a naked polynucleotide with a single or multiple copies of the specific nucleotide sequences that bind to specific DNA-binding sites of the apolipoproteins present on plasma lipoproteins as described in the current invention.
- the polynucleotide may encode a biologically active peptide, antisense RNA, or ribozyme and will be provided in a physiologically acceptable administrable form.
- Another pharmaceutical product that may spring from the current invention may include a highly purified plasma lipoprotein fraction, isolated according to the methodology, described herein from either the patients blood or other source, and a polynucleotide containing single or multiple copies of the specific nucleotide sequences that bind to specific DNA-binding sites of the apolipoproteins present on plasma lipoproteins, prebound to the purified lipoprotein fraction in a physiologically acceptable, administrable form.
- Yet another pharmaceutical product may include a highly purified plasma lipoprotein fraction which contains recombinant apolipoprotein fragments containing single or multiple copies of specific DNA-binding motifs, prebound to a polynucleotide containing single or multiple copies of the specific nucleotide sequences, in a physiologically acceptable administrable form.
- Yet another pharmaceutical product may include a highly purified plasma lipoprotein fraction which contains recombinant apolipoprotein fragments containing single or multiple copies of specific DNA-binding motifs, prebound to a polynucleotide containing single or multiple copies of the specific nucleotide sequences, in a physiologically acceptable administrable form.
- the dosage to be administered depends to a great extent on the body weight and physical condition of the subject being treated as well as the route of administration and frequency of treatment.
- a pharmaceutical composition that includes the naked polynucleotide prebound to a highly purified lipoprotein fraction may be administered in amounts ranging from 1 ⁇ g to 1 mg polynucleotide and 1 ⁇ g to 100 mg protein.
- Administration of the therapeutic virus particle to a patient will follow general protocols for the administration of chemotherapeutics, taking into account the toxicity, if any, of the vector. It is anticipated that the treatment cycles would be repeated as necessary. It also is contemplated that various standard therapies, as well as surgical intervention, may be applied in combination with the described gene therapy.
- Aqueous compositions of the present invention may include an effective amount of the compound, dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium. Such compositions can also be referred to as inocula.
- a pharmaceutically acceptable carrier or aqueous medium Such compositions can also be referred to as inocula.
- the use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients also can be incorporated into the compositions.
- the compositions of the present invention may include classic pharmaceutical preparations. Dispersions also can be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- compositions according to the present invention will be via any common route so long as the target tissue is available via that route in order to maximize the delivery of antigen to a site for maximum (or in some cases minimum) immune response.
- Administration will generally be by orthotopic, intradermal, subcutaneous, intramuscular, intraperitoneal or intravenous injection. Other areas for delivery include: oral, nasal, buccal, rectal, vaginal or topical. Topical administration would be particularly advantageous for treatment of skin cancers.
- Such compositions would normally be administered as pharmaceutically acceptable compositions that include physiologically acceptable carriers, buffers or other excipients.
- Vaccine or treatment compositions of the invention may be administered parenterally, by injection, for example, either subcutaneously or intramuscularly. Additional formulations which are suitable for other modes of administration include suppositories, and in some cases, oral formulations or formulations suitable for distribution as aerosols. In the case of the oral formulations, the manipulation of T-cell subsets employing adjuvants, antigen packaging, or the addition of individual cytokines to various formulation that result in improved oral vaccines with optimized immune responses.
- binders and carriers may include, for example, polyalkylene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1%-2%.
- Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain 10%-95% of active ingredient, preferably 25-70%.
- the antigen encoding nucleic acids of the invention may be formulated into the vaccine or treatment compositions as neutral or salt forms.
- Pharmaceutically acceptable salts include the acid addition salts (formed with free amino groups of the peptide) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or with organic acids such as acetic, oxalic, tartaric, maleic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
- Vaccine or treatment compositions are administered in a manner compatible with the dosage formulation, and in such amount as will be prophylactically and/or therapeutically effective.
- the quantity to be administered depends on the subject to be treated, including, e.g., capacity of the subject's immune system to synthesize antibodies, and the degree of protection or treatment desired.
- Suitable dosage ranges are of the order of several hundred micrograms active ingredient per vaccination with a range from about 0.1 mg to 1000 mg, such as in the range from about 1 mg to 300 mg, and preferably in the range from about 10 mg to 50 mg.
- Suitable regiments for initial administration and booster shots are also variable but are typified by an initial administration followed by subsequent inoculations or other administrations.
- nucleic acid molecule or fusion polypeptides of this invention will depend, inter alia, upon the administration schedule, the unit dose of antigen administered, whether the nucleic acid molecule or fusion polypeptide is administered in combination with other therapeutic agents, the immune status and health of the recipient, and the therapeutic activity of the particular nucleic acid molecule or fusion polypeptide.
- compositions can be given in a single dose schedule or in a multiple dose schedule.
- a multiple dose schedule is one in which a primary course of vaccination may include, e.g., 1-10 separate doses, followed by other doses given at subsequent time intervals required to maintain and or reinforce the immune response, for example, at 1-4 months for a second dose, and if needed, a subsequent dose(s) after several months.
- Periodic boosters at intervals of 1-5 years, usually 3 years, are desirable to maintain the desired levels of protective immunity.
- the course of the immunization can be followed by in vitro proliferation assays of peripheral blood lymphocytes (PBLs) co-cultured with ESAT6 or ST-CF, and by measuring the levels of IFN- ⁇ released from the primed lymphocytes.
- PBLs peripheral blood lymphocytes
- the assays may be performed using conventional labels, such as radionuclides, enzymes, fluorescent labels and the like. These techniques are known to one skilled in the art and can be found in U.S. Pat. Nos. 3,791,932, 4,174,384 and 3,949,064, relevant portions incorporated by reference.
- the modular rAb carrier and/or conjugated rAb carrier-(cohesion/dockerin and/or dockerin-cohesin)-antigen complex may be provided in one or more “unit doses” depending on whether the nucleic acid vectors are used, the final purified proteins, or the final vaccine form is used.
- Unit dose is defined as containing a predetermined-quantity of the therapeutic composition calculated to produce the desired responses in association with its administration, i.e., the appropriate route and treatment regimen.
- the quantity to be administered, and the particular route and formulation, are within the skill of those in the clinical arts.
- the subject to be treated may also be evaluated, in particular, the state of the subject's immune system and the protection desired.
- a unit dose need not be administered as a single injection but may include continuous infusion over a set period of time.
- Unit dose of the present invention may conveniently may be described in terms of DNA/kg (or protein/Kg) body weight, with ranges between about 0.05, 0.10, 0.15, 0.20, 0.25, 0.5, 1, 10, 50, 100, 1,000 or more mg/DNA or protein/kg body weight are administered.
- the amount of rAb-DC/DC-antigen vaccine delivered can vary from about 0.2 to about 8.0 mg/kg body weight.
- 0.4 mg, 0.5 mg, 0.8 mg, 1.0 mg, 1.5 mg, 2.0 mg, 2.5 mg, 3.0 mg, 4.0 mg, 5.0 mg, 5.5 mg, 6.0 mg, 6.5 mg, 7.0 mg and 7.5 mg of the vaccine may be delivered to an individual in vivo.
- the dosage of rAb-DC/DC-antigen vaccine to be administered depends to a great extent on the weight and physical condition of the subject being treated as well as the route of administration and the frequency of treatment.
- a pharmaceutical composition that includes a naked polynucleotide prebound to a liposomal or viral delivery vector may be administered in amounts ranging from 1 ⁇ g to 1 mg polynucleotide to 1 ⁇ g to 100 mg protein.
- compositions may include between about 1 ⁇ g, 5 ⁇ g, 10 ⁇ g, 20 ⁇ g, 30 ⁇ g, 40 ⁇ g, 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 100 ⁇ g, 150 ⁇ g, 200 ⁇ g, 250 ⁇ g, 500 ⁇ g, 600 ⁇ g, 700 ⁇ g, 800 ⁇ g, 900 ⁇ g or 1,000 ⁇ g polynucleotide or protein that is bound independently to 1 ⁇ g, 5 ⁇ g, 10 ⁇ g, 20 ⁇ g, 3.0 ⁇ g, 40 ⁇ g 50 ⁇ g, 60 ⁇ g, 70 ⁇ g, 80 ⁇ g, 100 ⁇ g, 150 ⁇ g, 200 ⁇ g, 250 ⁇ g, 500 ⁇ g, 600 ⁇ g, 700 ⁇ g, 800 ⁇ g, 900 ⁇ g, 1 mg, 1.5 mg, 5 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 80 mg, 90 mg or
- the present invention was tested in an in vitro cellular system that measures immune stimulation of human Flu-specific T cells by dendritic cells to which Flu antigen has been targeted.
- the results shown herein demonstrate the specific expansion of such antigen specific cells at doses of the antigen which are by themselves ineffective in this system.
- the present invention may also be used to make a modular rAb carrier that is, e.g., a recombinant humanized mAb (directed to a specific human dendritic cell receptor) complexed with protective antigens from Ricin, Anthrax toxin, and Staphylococcus B enterotoxin.
- a modular rAb carrier that is, e.g., a recombinant humanized mAb (directed to a specific human dendritic cell receptor) complexed with protective antigens from Ricin, Anthrax toxin, and Staphylococcus B enterotoxin.
- the potential market for this entity is vaccination of all military personel and stored vaccine held in reserve to administer to large population centers in response to any biothreat related to these agents.
- the invention has broad application to the design of vaccines in general, both for human and animal use. Industries of interest is pharmaceutical and biotechnology
- One commercial application of the invention is a recombinant humanized mAb (directed to the specific human dendritic cell receptor DCIR) fused through the Ab heavy chain to antigens known or suspected to encode protective antigens.
- these include as examples for vaccination against various agents—hemagglutinins from Influenza H5N1; HIV gag from attenuated toxins from Ricin, Anthrax toxin, and Staphylococcus B enterotoxin; ‘strings’ of antigenic peptides from melanona anigens, etc.
- the potential market for this entity is preventative or therapeutic vaccination of at risk or infected people.
- the invention has broad application for vaccination against many diseases and cancers, both for human and animal use. Industries of interest are pharmaceutical and biotechnology.
- this invention has implications beyond anti-DCIR application since it describes a method to identify particularly favorable sequences,to enhance secretion of recombinant antibodies.
- anti-DCIR combining regions for making engineered recombinant monoclonal antibodies fused to antigens as potent therapeutic or preventative vaccination agents.
- One type of therapeutic (in this case, vaccination) entity envisioned is a humanized DC-targeting mAb-antigen fusion protein, where the antibody variable region specificity is directed against an internalizing human dendritic cell receptor.
- the present state-of-the art is to engineer the fusion of the desired antigen to the C-terminus of the mAb H chain.
- This paradigm obviously allows different antigens (A1, A2, A3) to be engineered to the same proven targeting mAb backbone (Y in the figure below), thus extending the utility of the one mAb to immunizing against different pathogenic agents.
- This concept can be further extended by engineering, e.g., the A1, A2, A3 coding regions end-to-end fused to the IgGFc C-terminal coding region.
- the present invention disclosed a new paradigm for linking the antigen to the targeting mAb that extends the concept for the first time to multiple antigens targeted in a complex simultaneously with the same engineered humanized mAb (MATCHMAB).
- FIG. 1 compares the prior art (top portion) with an example of the multiple antigens targeted in a complex simultaneously with the same engineered humanized mAb (MATCHMAB) (bottom portion).
- Y represents the humanized anti-DC targeting mAb;
- A1, A2, A3 are independent protective antigens, or any other desired protein domains;
- C1, C2, C2 are specific high affinity capture domains for, respectively, docking domains D1, D2.
- D3; and DnAn are the corresponding docking-antigen fusion proteins. Note that the various domains are not drawn to scale.
- the mAb itself is ⁇ 150 kDa, C is ⁇ 17 Da, D is ⁇ 8 kDa and A varies, but is usually >20 kDa).
- the MATCHMAB is based on using cellulosome-assembly cohesin-dockerin sequences to form modular non-covalent targeting mAb-antigen complexes.
- the relatively small and specific cohesin-dockerin protein-protein interaction domains can allow simple customized formulation of targeting mAb-antigen complexes.
- a single manufactured humanized mAb in the above notation: Y.C1.C2.C3.Cn
- Y.C1.C2.C3.Cn can be use as the basis of delivering multiple antigens in various, yet strictly defined, combinations.
- Example of sequence encoding C1.C2.C3.Cn is taken from the public sequence >gi
- the cohesin domains (C) interact with small domains (e.g., 56 residues) called dockerins (D). These are Ca++ containing structures with two-fold symmetry and they can bind to a cognate cohesin with various affinities (e.g., 6E6 M, 2E7M). Affinities between dockerin and multiple cohesins (as found on scaffoldins) can be much higher (e.g., >E9 M).
- the interaction is non-covalent and is well defined (by structure analysis) for at least one C-D pair.
- Dockerins are designed to be domains linked to different domain (enzyme in nature), and cohesions are designed to function in linear arrays (either directly end-to-end, or joined by flexible PT-rich linkers of various sizes (e.g., 12, 17, 25, 28, 36). It is known that a particular dockerin can have specificity for a particular cohesin (e.g., a C-D pair from one bacterial species may not be interchangeable with a C-D pair from a different species). This feature makes it is possible to ensure the specific and precise interaction of various D-antigen fusion proteins with an engineered mAb containing cohesin domains of various specificities.
- this invention includes adapting C-D pairs known from the literature, newly gleamed from nature, or developed with new specificities using phage display technology.
- the latter technology can also be used to enhance (‘mature’) the affinity of a C-D interaction, should this be desired.
- engineering cysteine residues at opposing faces of the C-D interaction could be used to make a covalent bond between C-D to strengthen the interaction.
- dimeric nature of the mAb and therefore the linked C-domains
- the D-antigen fusion protein is engineered either with a second identical dockerin domain (D-antigen-D, or D-D-antigen), or with a homodimerization domain.
- D-antigen-D or D-D-antigen
- This configuration provided the linkers between domains were not constraining, will result in the preferred simultaneous binding of both D domains to the same mAb, with greatly enhanced stability compared to the single interaction.
- the linker sequences have a propensity for O-linked glycosylation resulting from ST richness.
- both the C and D domains can have potential N-linked sites.
- FIG. 2 shows the use of the present invention to form Bi-specific mAbs.
- mAb1 black
- mAb2 magenta
- C-terminal D1 C-terminal D1
- Mixing equimolar mAb1 and mAb2 will result in a bi-specific 1:1 complex.
- each mAb molecule contains two molar equivalents of C or D (the mAb is itself a dimeric structure)
- the bi-specific mAb will be greatly stabilized by two concurrent C-D interactions. Especially at lower (mAb), this will be the most stable configuration.
- Example 2 shows that particular cohesin and dockerin domains can be sucessfully and efficiently secreted from mammalian cells as fusion proteins while maintaining the specific and high affinity cohesin-dockerin protein-protein interaction. While the extensive cohesin-dockerin literature teaches the expectation that such fusion proteins should have this functionality, it does not describe production of such fusion proteins in mammalian secretion systems. The state of scientific knowledge does not allow the prediction of the discovery since the rules (other than features such as signal peptide) for successful secretion are not fully established. Furthermore, the cohesin linker regions are known to be glycosylated in their native bacteria, and the cohesin and dockerin domains contain predicted glycosylation sites. While this may actually favor secretion from mammalian cells, it is unclear if ‘unnatural’ glyosylation will perturb the cohesis-dockerin interaction.
- the invention includes the use of all cohesin-dockerin sequences from diverse cellulose degrading microbes, but describes the application of specific cohesin and dockerin and linker sequences from the microbe Clostridium thermocellum.
- the sequence described in Table 1 encodes the H chain of a human IgG4 linked at the C-terminal codon to a Clostridium thermocellum dockerin sequence (called rAb.doc).
- rAb.doc Clostridium thermocellum dockerin sequence
- Other embodiments of rAb.doc proteins are described similarly in Table 2 and these are engineered by simply transferring the dockerin coding region as a DNA fragment to vectors encoding the different H chain entities.
- TABLE 1 shows the nucleic acid and amino acid sequences for rAB-pIRES2(hIgG4H-Dockerin) or C52.
- DNA encoded from human IgG4H.doc fusion protein is shown below.
- the dockerin domain taken from Clostridium thermocellum celD is highlighted in yellow and the H chain and dockerin joining sequence is underlined.
- the highly predicted N-linked glycosylation site within the dockerin domain is highlighted in red.
- TABLE 2 shows the nucleic acid and amino acid sequences for rAB-pIRES2(mAnti-DCIR2C9H-LV-hIgG4H-C-Dockerin) or C82.
- DNA Entire coding region
- amino acid sequence the predicted secreted product
- the dockerin domain is highlighted in yellow and the H chain and dockerin joining sequence is underlined.
- the IgG variable region is highlighted in blue.
- the highly predicted N-linked glycosylation site within the dockerin domain is highlighted in red.
- TABLE 3 shows the nucleic acid and amino acid sequences for rAB-(mAnti-ASGPR — 49C11 — 7H-SLAML-V-hIgG4H-C-Dockerin) or C153.
- DNA Entire coding region
- amino acid sequence the predicted secreted product
- the dockerin domain is highlighted in yellow and the H chain and dockerin joining sequence is underlined.
- the IgG variable region is highlighted in blue.
- the highly predicted N-linked glycosylation site within the dockerin domain is highlighted in red.
- TABLE 4 shows the nucleic acid and amino acid sequences for rAB-pIRES2(mAnti-DC-SIGNL16E7H-LV-hIgG4H-C-Dockerin) or C92.
- DNA Entire coding region
- amino acid sequence the predicted secreted product
- the dockerin domain is highlighted in yellow and the H chain and dockerin joining sequence is underlined.
- the IgG variable region is highlighted in blue.
- the highly predicted N-linked glycosylation site within the dockerin domain is highlighted in red.
- Mammalian expression plasmids encoding such rAb.doc IgG H chain proteins are created using standard molecular biology techniques and can be based on commercially available expression plasmid vectors such as pIRES2-DsRed2 (BD Biosciences).
- mammalian cells are co-transfected with this expression plasmid and an expression plasmid encoding a complimentary IgG L chain (exemplified in Table 3). Standard protocols (such as the FreeStyleTM 293 Expression System, Invitrogen) are used as for mammalian cells, transfection reagents, and culture media. Transfected cells are cultured for 3-7 days and the culture supernatant is harvested by centrifugation, clarified by filtration, and the rAB.doc protein purified by Protein G affinity chromatography using protocols from the column manufacturer (GE Pharmacia).
- FIG. 3 shows analysis of typical secreted rAb.doc products by reducing SDS.PAGE with staining by Coomassie Brilliant Blue. This analysis shows that the rAb.doc is efficiently produced as a secreted H+L chain dimer. Heterogeneity in the H chain likely reflects N-linked glycosylation at a highly predicted (Potential 0.6426, NetNGlyc 1.0 Server—Technical University of Denmark) site within the dockerin sequence.
- TABLE 5 shows the nucleic acid and amino acid sequences for rAB-pIRES2(mAnti-DC-SIGNL16E7K-LV-hIgGK-C) or C73.
- DNA Entire coding region
- amino acid sequence the predicted secreted product
- IgG Kappa protein fusing the V region from the mAnti-DC-SIGNL16E7 hybridoma (highlighted in blue)to a human C region (highlighted in yellow).
- FIG. 3 shows Protein G affinity purified secreted rAb proteins analyzed by reducing SDS.PAGE and Coomassie Brilliant Blue staining. Lanes are from left to right.
- the invention enbodies the unanticipated presence and use of this glycosylation site that likely confers onto mammalian cell-secreted dockerin fusion proteins desirable solubility and pharmacokinetic properties well known to be associated with glycosylation.
- FIG. 2 shows that rAb.antigen fusion proteins employing identical IgG H and L sequences can differ dramatically in efficiency of secretion. In both sited examples, rAb.doc entities are well expressed compared to rAb fused to Influenza HAS sequences which typically express very poorly.
- the invention also embodies the unanticipated capacity of the dockerin domain to not significantly hinder the secretion of the associated rAb entity.
- the invention embodies the property of the dockerin domain to not hinder the functionality of the rAb specific antigen combining regions.
- This property is exemplified in FIG. 5 which shows concordance between IgFc reactivity and LOX-1 reactivity between anti-LOX1 — 15C4 rAb proteins and anti-LOX1 — 15C4.doc.
- FIGS. 4A and 4B show the measurement by anti-human IgFc ELISA of levels of secretion of various rAb.fusion proteins.
- 2.5 ug each of the H and L chain expression plasmids were transfected into 293F cells and two-fold dilutions of supernatant samples were tested after three days of culture.
- Y axis values are arbitrary HRP activity.
- FIG. 5 shows the measurement by anti-human IgFc ELISA (HRP activity) and LOX-1.alkaline phoshatase binding (AP activity) of secreted anti-LOX1 — 15C4 rAb.(blue symbols)and anti-LOX1 — 15C4.doc rAb (red symbols) proteins.
- HRP activity anti-human IgFc ELISA
- AP activity LOX-1.alkaline phoshatase binding
- the invention embodies the property of the dockerin domain to be efficiently and functionally expressed in the context of fusion proteins other than hIgG4 and its close derivatives.
- Table 6 shows the sequence of a rAb.doc entity based on a mouse IgG2b H chain fusion protein.
- TABLE 6 shows the nucleic acid and amino acid sequences for rAB-pCMV(mIgG2bH-Dockerin) or C19.
- DNA Entire coding region
- amino acid sequence the predicted secreted product
- the dockerin domain is highlighted in yellow and the H chain and dockerin joining sequence is underlined.
- the highly predicted N-linked glycosylation site within the dockerin domain is highlighted in red.
- FIG. 6 shows that when co-transfected with a mIgG kappa expression plasmid, rAB-pCMV(mIgG2bH-Dockerin) plasmid directs the efficient secretion of rAB-mIgG2b.Dockerin fusion protein.
- rAB-pCMV(mIgG2bH-Dockerin) plasmid directs the efficient secretion of rAB-mIgG2b.Dockerin fusion protein.
- FIG. 6 shows that when co-transfected with a mIgG kappa expression plasmid, rAB-pCMV(mIgG2bH-Dockerin) plasmid directs the efficient secretion of rAB-mIgG2b.Dockerin fusion protein.
- FIG. 6 shows that when co-transfected with a mIgG kappa expression plasmid, rAB-pCMV(mIg
- rAb.doc The use of the rAb.doc invention detailed above is the assembly of rAb-antigen or toxin or activator or enzyme complexes via the specificity and tenacity of the dockerin-cohesin interaction.
- Table 5 shows one embodiment of the invention in the form of a cohesin.alkaline phosphatase fusion protein (coh.AP).
- alkaline phosphatase fusion protein containing two cohesion domains coh.coh.AP
- other proteins are examples of the generality of the invention such as the single cohesin domain fused to other sequences such as the mature sequence of human prostate specific antigen (coh.hPSA) and to the HA 1 domain of influenza A HAS (coh.Flu HA5-1).
- TABLE 7 shows the nucleic acid and amino acid sequences for Mam-pCDM8(Cohesin-SLAML-AP-6 ⁇ His) or C16.
- DNA Entire coding region
- amino acid sequence the predicted secreted product
- the cohesin domain is highlighted in yellow and the cohesin and alkaline phosphatase joining sequence is underlined.
- the highly predicted G-score>0.5, NetOGlyc 3.1 Server—Technical University of Denmark
- O-linked glycosylation sites within the cohesin domain and the linker distal to the cohesin domain are highlighted in red. Residues highlighted grey are a C-terminal His tag to facilitate purification via metal affinity chromatography.
- TABLE 8 shows the nucleic acid and amino acid sequences for Mam-pCDM8(Cohesin-Cohesin-SLAML-AP-6 ⁇ His) or C17.
- DNA Entire coding region
- amino acid sequence the predicted secreted product
- the cohesin domain is highlighted in yellow and the cohesin and alkaline phosphatase joining sequence is underlined.
- the highly predicted O-linked glycosylation sites within the linker distal to the cohesin domains are highlighted in red as is a single highy predicted N-linked glycosylation site (NPT). Residues highlighted grey are a C-terminal His tag to facilitate purificaytion via metal affinity chromatography.
- TABLE 9 shows the nucleic acid and amino acid sequences for Mam-pCDM8(SLAML-Cohesin-hPSA) or C149.
- DNA Entire coding region
- amino acid sequence the predicted secreted product
- the cohesin domain is highlighted in yellow and the cohesin and hPSA joining sequence is underlined.
- the highly predicted O-linked glycosylation sites within the linker distal to the cohesin domains and a single highly predicted N-linked glycosylation site within the cohesin domain are highlighted in red.
- TABLE 10 shows the nucleic acid and amino acid sequences for Mam-pCDM8(SLAML-Cohesin-FluHA5-1-6 ⁇ His) or C24.
- DNA Entire coding region
- amino acid sequence the predicted secreted product
- the cohesin domain is highlighted in yellow and the cohesin and Flu HA5-1 joining sequence is underlined.
- the highly predicted O-linked glycosylation sites within the linker distal to the cohesin domains and a single highly predicted N-linked glycosylation site within the cohesin domain are highlighted in red. Residues highlighted grey are a C-terminal His tag to facilitate purification via metal affinity chromatography.
- the invention embodies the efficient secretion from mammalian cells of functional cohesin fusion proteins (called herein coh.fusions). It was not obvious that cohesin domains could be so successfully secreted while retaining dockerin-binding function.
- FIG. 5 demonstrates that supernatant containing secreted coh.alkaline phosphatase (coh.AP) binds specifically to a rAb.doc protein immobilized on a plastic surface.
- FIGS. 7A and 7B show that the Expression plasmids encoding secreted alkaline phosphatase (AP) or coh.AP directed secretion of functional proteins from transfected 293F cells. After 3 days of culture supernatants were harvested and tested for their ability to bind 0.25 ug of either rAb.doc (top panel) or rAb (lower panel) bound to a 96 well micro-titre plate. After 1 hr of incubation the plates were washed and developed with a chromogenic AP substrate.
- AP alkaline phosphatase
- the invention embodies the application of assembly of specific protein complexes based on the cohesin.dockerin interaction.
- Specific antibody.antigen complexes can also be assembled using the established interaction of protein A or protein G IgFc binding domains.
- the invention embodies unique properties of the cohesin.dockerin interaction that result in greatly superior complex formation compared to the e.g., protein G interaction with IgG.
- FIGS. 6 and 7 the interaction of a cohesin.AP (called Coh.AP) protein is shown to be specific for a rAb.Doc protein.
- FIGS. 8A and 8B shows various dilutions of a supernatant containing secreted G.AP were incubated for 1 hr in micro-titre wells containing 0.25 ug of immobilized mIgG2a, mIgG2b, or a mIgG2b-based rAb.doc. After washing the bound AP activity was developed using chromogenic AP substrate.
- the proG.AP did not bind to the rAb.doc since it was an isotype variant of mIgG2b that did not interact with the particular protein G domain used in the proG.AP construct.
- FIG. 8B shows an identical study, but employing dilutions of a supernatant containing secreted Coh.AP.
- Coh.AP binds only to rAb.doc, again demonstrating the specificity of the coh.doc interaction.
- FIG. 9 demonstrates the vastly superior stability of preassembled complexes based on coh.doc interaction compared to proG.IgGFc interaction.
- FIG. 9 shows the formation of complexes between a fixed amount of proG.AP or coh.AP or coh2.AP (0.1 ug) and immobilized mIgG2b or rAb.doc (0.25 ug) were assembled by incubation for 1 hr in a micro-titre plate. At various times a 20-fold excess of soluble mIgG2b or rAb.doc were added and incubation continued for various times. Plates were then washed and bound AP activity accessed by addition of chromogenic AP substrate.
- FIG. 10 demonstrates the vast superiority of coh.doc complexes compared to proG.IgGFc complexes in such a setting. Under the conditions used, ⁇ 15 ug/ml Ig was sufficient to completely displace bound proG.AP, while the coh.AP remained stably bound to rAb.doc even in the presence of pure serum (15 mg/ml Ig)
- FIG. 10 shows the formation of complexes between a fixed amount of proG.AP or coh.AP (0.1 ug) and immobilized mIgG2b or rAb.doc (0.25 ug) were assembled by incubation for 1 hr in a micro-titre plate. Various dilutions of human serum were added and incubation continued for 4 hrs. Plates were then washed and bound AP activity accessed by addition of chromogenic AP substrate.
- the invention also embodies a particular utility of the coh.doc interaction that permits a production process that ensures complete complex formation and that can be concomitant with a purification process for the coh.fusion protein entity.
- This invention is exemplified in FIGS. 11 and 12 , which illustrate this process via sequential capture of rAb.doc from culture supernatant by protein G affinity chromatography, followed by capture of coh.antigen from culture supernatant by the proteinG:rAb.doc column. Elution with low pH then releases pure rAb.doc:coh.antigen. If there is an excess of coh.antigen over rAb.doc, them full and complete complex should result.
- a related embodiment of this invention would be application to the protein G captured rAb.doc of excess pure or partially purified coh.fusion protein.
- FIG. 11 shows a gel of reduced vs. non-reduced SDS.PAGE analysis of rAb.doc:Coh2.AP complexes produced by sequential application of rAb.doc supernatant and coh.AP supernatant to the same protein G affinity column. Lanes 2 and 4 show that Coh2.AP co-purifies with rAb.doc.
- FIG. 12 is a non-reduced SDS.PAGE analysis of rAb.doc:Coh.Flu HA5-1 complexes produced by sequential application of rAb.doc supernatant and coh.Flu HA5-1 supernatant to the same protein G affinity column. Lanes 1 to 4 left to right show that Coh.Flu HA5-1 co-purifies with rAb.doc.
- a well described feature of cohesin domains is their compatibility with the standard E. coli bacterial expression system.
- the invention embodies the novel use of expression of dockerin fusion proteins in mammalian secretion systems, and it also encompasses the formation of coh.doc complexes where the different components (i.e., coh and doc) are expressed in different systems. This is a great advantage since it affords the possibility of using the most favorable expression system for each component.
- coh.Flu M1 expression constructs failed to efficiently direct the synthesis of secreted product from transfected mammalian cells.
- coh.Flu M1 was very efficiently expressed as a soluble protein in E. coli. Table 6 shows the sequence of the coh.Flu M1 used in this example.
- TABLE 11 shows the nucleic and amino acid sequence for E coli -pET28(Cohesin-FluM1-6 ⁇ His) or C32 is shown below.
- the cohesin domain is highlighted in yellow and the point of fusion between cohesion and influenza A M1 protein is underlined.
- Residues highliighted grey are a C-terminal His tag to facilitate purificaytion via metal affinity chromatography.
- E coli -pET28 (Cohesin-FluM1-6x-His) or C32.
- SEQ ID NO.: 22 ATGGATCTGGATGCAGTAAGGATTAAAGTGGACACAGTAAATGCAA AACCGGGAGACACAGTAAATATACCTGTAAGATTCAGTGGTATACC ATCCAAGGGAATAGCAAACTGTGACTTTGTATACAGCTATGACCCG AATGTACTTGAGATAATAGAGATAAAACCGGGAGAATTGATAGTTG ACCCGAATCCTACCAAGAGCTTTGATACTGCAGTATATCCTGACAG AAAGATGATAGTATTCCTGTTTGCGGAAGACAGCGGAACAGGAGCG TATGCAATAACTAAAGACGGAGTATTTGCTACGATAGTAGCGAAAG TAAAAGAAGGAGCACCTAACGGGCTCAGTGTAATCAAATTTGTAGA AGTAGGCGGATTTGCGAACAATGACCTTGTAGAACAGAAGACACAG TTCTTTGACGGTGGAGTAAATGTTGGAG TAA
- the invention embodies the use of the dockerin.cohesin interaction to assemble ordered and specific complexes for various therapeutic or vaccination purposes.
- An example is the use of rAb.doc with binding specificity to an internalizing human Dendritic Cell (DC) receptor complexed with coh.Flu M1 protein.
- FIG. 11 demonstrates this utility by an in vitro study. DC cultured with anti-DC_rAb.doc:coh.Flu M1, then co-cultured with autologous T cells, directed the expansion of T cells with specific memory of Flu M1. Equivalent doses of coh.Flu M1 alone had no such effect. The study shows at least a 50-fold enhancement of Flu M1-specific T cell expansion via the anti-DC_rAb.doc:coh.Flu M1 compared to coh.Flu M1 alone.
- FIG. 13 shows that functional anti-DC_rAb.doc:coh.Flu M1 complex was formed by mixing the individual purified components.
- Various amounts of the complex, or coh.Flu M1 alone, were incubated in culture medium with 5E4 human DC (from a HLA201 donor) and 10E5 autologous T cells. After 24 hr, the DC were activated with CD40L and incubation was continued for an additional 9 days.
- Cells were harvested and stained with a PE-labeled Flu M1 peptide GILGFVFTL (SEQ ID NO.:24) HLA-A2 tetramer and analyzed for the frequency of antigen-specific CD8+ cells.
- FIG. 14 shows a similar example incorporating the additional control of coh.Flu M1 complexed to an isotype-matched mAb.doc with no binding to the human DC.
- FIG. 12 shows that Anti-DC_rAb directly linked via an H chain fusion to a peptide fragment spanning the Flu M1 GILGFVFTL epitope is also effective in eliciting DC targeted antigen delivery resulting in expansion of Flu M1-specific T cells.
- the Anti-DC_rAb.Flu M1 PEP entity was secreted very poorly from mammalian cells, likely precluding production of such a vaccine. This problem illustrates the embodiment of the invention that allows production issues to be solved by employing expression systems appropriate for the (in this case) vaccine antigen.
- FIG. 14 shows that Anti-DC_rAb.doc:coh.Flu M1 or mIgG2b.doc:coh.Flu M1 complexes were formed by mixing the individual purified components. Various amounts of the complexes, or coh.Flu M1 alone, were incubated in culture medium with 5E4 human DC (from a HLA201 donor) and 10E5 autologous T cells. After 24 hr, the DC were activated with CD40L and incubation was continued for an additional 9 days.
- FIG. 15 shows CD34+ human DC were sorted into CD1a+ and CD14+ subtypes and cultured with and without 3 nM Anti-DC_rAb.Flu M1 PEP or Anti-DC_rAb. Autologous T cells were added after 1 day and culture continued for a further 8 days. Analysis was as described above. The CD1a+ cells were very efficient in expanding Flu MI-specific CD8+ cells only with Anti-DC rAb.Flu M1 PEP treatment.
- While one type of embodiment of the invention is a vaccine composed of an Anti-DC-rAb.doc:coh.antigen complex, it is envisioned that in some cases a preferred DC-targeting vaccine will be Anti-DC-rAb.antigen where antigen is likely a string of protective antigens. Identification of such antigens in efficacious combinations compatible with efficient expression in production systems is extremely problematic.
- One embodiment of the invention affords a method to streamline testing of antigen epitope combinations for the development of such vaccines. Specifically, the invention teaches a method to screen likely antigen epitopes alone and in combinations for efficacy as a prelude to addressing production of the desired Anti-DC-rAb.antigen.
- TABLE 13 shows the sequences of exemplative cohesin.peptide constructs which can be readily expressed via E. coli systems. Using techniques similar to those described in FIG. 11 , diverse collections of coh.pep proteins can be readily tested for efficacy as complexes with a single anti-DC_rAb.doc entity. The most efficacious coh.pep compounds can then be engineered directly as anti-DC_rAb.peptide fusion proteins.
- FIG. 16 shows examples of purified coh.PEP proteins expressed in E. coli.
- TABLE 12 shows the amino acid sequence of the melanoma-associated antigen gp100.
- Well known HLA-A201-restricted dominant peptides are shaded and detailed below the sequence.
- Peptide sequences labeled M are variants with enhanced affinity for HLA-A201.
- C180 is an E. coli expression construct that encodes the sequence shown below in which the cohesin domain is shaded blue and the gp100 peptide is shaded grey. Underlined residues bounding the peptide are native to gp100.
- C-terminal His tags are to facilitate purification via metal affinity chromatography.
- GP100 WT 154-162: KTWGQYWQV (SEQ ID NO.: 26) GP100 M: 209-217 (2M): IMDQVPFSV; (SEQ ID NO.: 27) 209-217 WT: ITDQVPFSV (SEQ ID NO.: 28) GP100 M: 280-288 (9V): YLEPGPVTV (SEQ ID NO.: 29) 280-288 WT: YLEPGPVTA (SEQ ID NO.: 30)
- C180 is E. coli -pET28(Cohesin-hgp100-PeptideA-6 ⁇ His):
- TABLE 13 shows the amino acid sequence of the melanoma antigen MART-1.
- Well known HLA-A201-restricted dominant peptides are shaded and detailed below the sequence.
- M peptides show peptide sequence variants with enhanced affinity for HLA-A201.
- C181 is an E. coli expression construct that encodes the sequence shown below in which the cohesin domain is shaded yellow and the MART-1 peptide is shaded grey. Underlined residues bounding the peptide are native to MART-1.
- C172 and C174 are two constructs directing the expression of anti-DC_rAb.MART-1 peptide and a matching control rAb.MART-1 peptide H chain. Only the sequences appended to the C-terminal residue are shown.
- C-terminal His tags are to facilitate purification via metal affinity chromatography.
- MART-1 is:
- C181 is E. coli -pET28(Cohesin-hMART-1-PeptideB-6 ⁇ His)
- C186 is E. coli -pET28(Cohesin-Flex-hMART-1-PeptideA-6 ⁇ His)
- C172 is rAB-pIRES2(mAnti-ASGPR — 49C11 — 7H-LV-hIgG4H-hMART-1-PeptideA)
- C174 is rAB-pIRES2(hIgG4H-hMART-1-PeptideA)
- FIG. 16 shows E. coli harboring expression plasmids directing the synthesis of coh.pep proteins were grown and induced for specific protein production. Cells were harvested and broken by sonication. The supernatant fractions were applied purified by metal affinity chromatography. Analysis was by reducing SDS.PAGE gel stained by Coomassie Brilliant Blue. The figure shows typical product coh.pep proteins labeled from left to right.
- Cohesin.dockerin modules exist in diverse cellulose degrading species. While they have sequence similarities, they can have specificities that do not cross between species. This affords an opportunity to build novel scaffolds composed of cohesins with different specificities and use this scaffold to assemble high order complexes in a spatially and numerically controlled manner. Others have described the core technology for using this notion for biotechnology applications (see Fierobe, H.-P., Mechaly, A., Tardif, C., Belaich, A., Lamed, R., Shoham, Y., Belaich, J.-P., and Bayer, E. A.
- the invention embodies the specific use of this technology for applications related to manufacture of rAb.(doc:coh.fusion)n complexes where n represents >1 pairings of doc:coh interactions with unique specificities.
- the invention envisions the assembly (by simple mixing of components) of spatially ordered complexes between rAb.doc1.doc2.doc3.etc. and coh1 .fusionA, coh2.fusionB, coh3.fusion3, etc.
- the coh.fusion proteins could represent different antigens, or combinations of antigens and activating agents like cytokines.
- CBD cellulose binding domains
- Clostridium thermocellum shows that the N and C-termini are in close proximity and are not an integral part of the CBD functional structure.
- CBD typically occurs linked to other domains such as coh.CBD.coh in cipA.
- the invention encompasses the use of entities such as coh.CBD.coh to assemble spatially and numerically ordered complexes mimicking antibodies and multi subunit receptors.
- a IgG kappa chain v region fused to doc1 and a IgG H chain V region linked to doc2 can assemble with coh1.CBD.coh2 to yield VL.doc1:coh1.CBD.coh2:VH.doc2 to yield an entity with affinity and binding specificity analogous to the original mAb.
- entities should be e.g., very useful screening tools for refining mAb specificities through mutagenesis procedures, particularly since the VL and VH component could be mutated independently and combined by mixing in various combinations.
- this technology can be readily extended to multiple controlled coh:V.doc combinations potentially yielding binding entities with extremely high specificities and affinities.
- PE Pseudomonas exotoxin A
- Anti-cancer agents are produced by deleting its binding domain (aa 1-252) and replacing it with the Fv fragment of an antibody or with a growth factor that binds to antigens present on cancer cells. These agents are termed recombinant immunotoxins (RITs).
- RITs have been made that target Ley present on colon, breast, lung and other epithelial cancers (B3(Fv)-PE38), that target the EGF receptor overexpressed on glioblastomas (TGF-alpha-PE38), that target mutant EGF receptors present on glioblastomas (MR-1(Fv)-PE38KDEL), and that target the IL-2 receptor present on many T and B cell leukemias and lymphomas LMB-2 or anti-Tac(Fv)-PE38 and that target CD22 on B cell malignancies and that target BL22 or RFB4(dsFv)-PE38 ovarian cancers and mesotheliomas (SS IP). These agents are produced in E.
- an ideal immunotoxin should be very active so that only small amounts need to be given to cause tumor regressions, stable so it remains functional during the 5-10 hours required to reach the interior of a tumor, and non immunogenic so it can be given repeatedly.
- recombinant immunotoxins contained amino acids 253-613 of PE (domains II and III). It has been determined that amino acids 364-395 can be deleted without loss of activity. Increased stability can be addressed by linking the toxin to a whole antibody, which are well known to have long half-lives and the technology in the invention provides this solution.
- rAb.Doc:Coh.toxin technology can be applied to known cancer antigens, it can also be tested to kill intra-tumoral DC that are suspected to foster escape of the tumor from immune surveillance.
- anti-DC toxin therapy could be doubly advantageous since build up of immunity against the administered toxin itself should be suppressed (that is because DC themselves are key to the initiation of this immune response via uptake and processing of the antigen. In this therapy, the DCs that uptake the antigen die and cannot mount the anti-toxin response).
- cohesin.toxin is produced independently, one formulation of the toxin can be conjugated to any number of separately produced targeting rAb.Doc proteins by simple mixing of the component prior to injection of the patient. This greatly simplifies manufacturing as well as research development time.
- the technology described in the invention can be readily applied to any toxin and any rAb specificity.
- PE38-N3 cacggtcaccgtctccaaagcttccggagctagcGAGGGCGGCAGCCTG GCCGCGCT (SEQ ID NO.: 39)
- PE38-C3 GGCCGGCTCCTGCGAAGGGAGCCGGCCGGTCGCGGCCGCTTACTTCAGG TCCTCGCGCGGCGGTTTGCCG (SEQ ID NO.: 40)
- Cloning was into the previously established construct C21 or E. coli -pET28(Cohesin-6 ⁇ His) to generate a fusion protein encoding Cohesin-PE38 corresponding to the amino acid sequence shown below (grey residues are cohesin; yellow residues are PE38, separated by a linker sequence native to the cohesin domain).
- FIG. 17 shows that the DCIR.Doc rAb alone had no effect upon the survival of DCs. However, DC-SIGN/L alone has a survival enhancing effect upon the DC (evidenced both by the scatter analysis and the 7-AAD staining.
- FIG. 18 shows that Coh.PE38 alone slightly increase the number of 7-AAD scored apoptotic cells (from 22.1-29.8%). However, targeting the Coh.PE38 toxin via DCIR.Doc increased the 7-AAD positive population to 55.3%. The scatter analysis even more dramatically revealed an almost complete loss of the population characteristic of viable DC.
- Cohesin domain was engineered in-frame with the C-terminus of a rAb H chain using PCR based on C17 (Mam-pCDM8(Cohesin-Cohesin-SLAML-AP-6 ⁇ His))as template.
- the resulting secreted H chain sequence is shown below (the cohesin domain is highlighted in grey and the C-terminal H chain residue is in bold):
- FIG. 19 shows the expression of anti-DC-SIGN/L and Anti-DC-ASPGR rAb.Coh were efficiently secreted.
- a fusion protein between a Cohesin domain and IL-21 was engineered as an expression construct and the Coh.IL-21 protein was efficiently secreted from transiently transfected 293F cells and easily purified by sequential Q Sepharose and anti-Cohesin affinity chromatography. The sequence of the secreted product is shown below with the cohesin domain shown in grey and the IL-21 domain in yellow. This product was fully functional as determined by it's efficacy in sustaining proliferation of human B cells.
- rAb.Doc:Coh.IL-21 can deliver concomitant proliferation and activation signals to a B cell (i.e., if the rAb itself has activation properties).
- This notion can be extended to any rAb with biological properties directed to a particular cell type and any cytokine with activity directed to the same cell type.
- FIG. 20 shows the effect of IL-21 and Coh.IL-21 on the proliferation of human B cells.
- compositions of the invention can be used to achieve methods of the invention.
- the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps.
- A, B, C, or combinations thereof refers to all permutations and combinations of the listed items preceding the term.
- “A, B, C, or combinations thereof” is intended to include at least one of: A, B, C, AB, AC, BC, or ABC, and if order is important in a particular context, also BA, CA, CB, CBA, BCA, ACB, BAC, or CAB.
- expressly included are combinations that contain repeats of one or more item or term, such as BB, AAA, MB, BBC, AAABCCCC, CBBAAA, CABABB, and so forth.
- BB BB
- AAA AAA
- MB BBC
- AAABCCCCCC CBBAAA
- CABABB CABABB
- compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
Abstract
Description
- This application claims priority to U.S. Provisional Application Ser. No. 60/888,029, filed Feb. 2, 2007, the contents of which is incorporated by reference herein in its entirety.
- This invention was made with U.S. Government support under Contract No. 1U19AI057234-0100003 awarded by the NIH. The government has certain rights in this invention.
- The present invention relates in general to the field of novel vaccines, and more particularly, to the design, manufacture and use of multivariable antigens complexed with targeting humanized monoclonal antibodies.
- Without limiting the scope of the invention, its background is described in connection with vaccine development.
- Protein engineering technology relating to monoclonal antibodies is highy advanced regarding humanization (i.e., rendering e.g., a rodent mAb sequence into a human mAb sequence while preserving specific antigen combining sites of the the original mAb) and production (typically secreted from mammalian cell lines). In research and development are new applications of rAbs related to vaccination and are presently based on engineered rAb-antigen fusion proteins (typically with the antigen coding region placed in-frame with the C-terminal codon of the rAb heavy or H chain). A roadblock to this technology is the successful expression and production of fully functional rAb-antigen. In many, perhaps most, cases the desired antigen confounds secretion of the engineered rAb-antigen. Also, the likelihood of poor or null expression is increased if the desired entity includes multiple antigen coding regions.
- The invention provides methods for the assembly of rAb antigen complexes in a controlled manner by simple mixing components and accomodates the ability to express and produce the rAb and antigen(s) in different expression—production systems that are best suited to the individual rAb and particular antigen. In addition, the invention demonstrates the novel application of the high affinity and high specificity cohesin-dockerin interaction to secreted mammalian expression systems, thus permitting the development of unique protein engineering formats and production of new protein tools for research and clinical application.
- More particularly, the present invention uses the cohesin-dockerin protein domains and their surrounding linker. For example, the invention permits the controlled assembly of recombinant monoclonal antibodies (rAbs) complexed to antigens, toxins, or cellular activating agents. The invention has wide potential application in vaccination and cancer therapy. Also claimed are derivatives of this technology that permit the production of novel proteins with specific affinities for other proteins.
- The invention is based on particular components of the well studied bacterial cellulose degrading protein complex called the cellulosome. Specifically, two protein domains (cohesin and dockerin) and natural protein linker sequences are utilized via the invention in novel contexts and applications.
- The present invention is based on the discovery that particular cohesin and dockerin domains can be sucessfully and efficiently secreted from mammalian cells as fusion proteins while maintaining the specific and high affinity cohesin-dockerin protein-protein interaction. While the extensive cohesin-dockerin literature teaches the expectation that such fusion proteins should have this functionality, it does not describe production of such fusion proteins in mammalian secretion systems. The state of scientific knowledge does not allow the prediction of the discovery since the rules (other than features such as signal peptide) for successful secretion are not fully established. Furthermore, the cohesin linker regions are known to be glycosylated in their native bacteria, and the cohesin and dockerin domains contain predicted glycosylation sites. While this may actually favor secretion from mammalian cells, it is unclear if ‘unnatural’ glyosylation will perturb the cohesis-dockerin interaction.
- While cohesin-dockerin interaction for various commercial applications has been published, the present invention is based on a previously unrealized potential for this interaction built around assembling specific protein complexes unrelated to the controlled assembly enzyme applications.
- The invention includes the use of all cohesin-dockerin sequences from diverse cellulose degrading microbes, but describes the application of specific cohesin and dockerin and linker sequences from the microbe Clostridium thermocellum. For example, the sequence described herein encodes the H chain of a human IgG4 linked at the C-terminal codon to a Clostridium thermocellum dockerin sequence (called rAb.doc). Other embodiments of rAb.doc proteins are described similarly with examples that are engineered by simply transferring the dockerin coding region as a DNA fragment to vectors encoding the different H chain entities.
- More particularly, the present invention includes a modular rAb carrier that includes an antigen-specific binding domain linked to one or more antigen carrier domains and one half of a cohesin-dockerin binding pair. The antigen-specific binding domain may be at least a portion of an antibody and the antibody is a fusion protein with and the binding pair in a fusion protein with one half of a cohesin-dockerin binding pair. The rAb may also include a complementary half of the cohesin-dockerin binding pair bound to an antigen that forms a complex with the modular rAb carrier. The complementary half of the cohesin-dockerin binding pair may itself be a fusion protein with the antigen carried as part of the complex (modular rAb carrier (cohesin/dockerin) antigen complex). Examples of antigen specific domain include a full length antibody, an antibody variable region domain, an Fab fragment, a Fab′ fragment, an F(ab)2 fragment, and Fv fragment, and Fabc fragment and/or a Fab fragment with portions of the Fc domain. Non limiting examples of sources for the cohesin-dockerin binding pair include Clostridium thermocellum, Clostridium josui, Clostridium cellulolyticum and Bacteroides cellulosolvens and combinations thereof.
- Non-limiting examples for targeting by the antigen-specific binding domain include: cell surface marker selected from MHC class I, MHC class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD 19, CD20, CD29, CD31, CD40,CD43, CD44, CD45, CD54, CD56, CD57, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40, BDCA-2, MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1, B7-2, IFN-γ receptor and IL-2 receptor, ICAM-1, Fcγ receptor or other receptor relatively specifically expressed by antigen presenting cells.
- The rAb of the present invention may also includes combinations of the domains that are defined as: an rAb.Doc; an rAb.Coh; an rAb.(Coh)x; an rAb.(Doc)x; an rAb.(Coh.Doc)x; or an rAb.(Coh)x(Doc)x; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. Examples of the modular rAb carrier in a complex include:
- an rAb.Doc:Coh.antigen;
- an rAb.Coh:Doc.antigen;
- an rAb.(Coh)x:(Doc.antigen)x;
- an rAb.(Doc)x:(Coh.antigen)x;
- an rAb.(Coh.Doc)x:(Doc.antigen1)(Coh.antigen2); or
- an rAb.(Coh)x(Doc)x:(Doc.antigen1)x(Coh.antigen2)x;
- wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- The present invention also include a vaccine of a modular rAb carrier that includes an antigen specific domain linked to one or more domains comprising one half of the cohesin-dockerin binding pair bound to a complementary half of the cohesin-dockerin binding pair bound to an antigen. Non-limiting examples for targeting the rAb include immune cell surface protein selected from MHC class I, MHC class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD 19, CD20, CD29, CD31, CD40,CD43, CD44,CD45, CD54, CD56, CD57, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40, BDCA-2, MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1, B7-2, IFN-γ receptor and IL-2 receptor, ICAM-1, Fcγ receptor or other receptor relatively specifically expressed by antigen presenting cells. Targets for vaccination with the rAb antigen carrier include, e.g., a bacterial, viral, fungal, protozoan or cancer protein and fragments thereof. The vaccine of
claim 11, wherein the modular rAb carrier is further defined: an rAb.Doc:Coh.antigen; an rAb.Coh:Doc.antigen; an rAb.(Coh)x:(Doc.antigen)x; an rAb.(Doc)x:(Coh.antigen)x; an rAb.(Coh.Doc)x:(Doc.antigen1)(Coh.antigen2); or an rAb.(Coh)x(Doc)x:(Doc.antigen1)x(Coh.antigen2)x; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. - The present invention also includes an isolated nucleic acid comprising a coding segment for a target-specific domain and one or more domains and one half of a cohesin-dockerin binding pair. For example, the target may be an antigen and the target specific domain may encode at least a portion of an antibody. The one or more domains can encode one or more cohesin domains, one or more dockerin domains or a combination of one or more cohesin and dockerin domains. The rAb is further defined as: an rAb.Doc; an rAb.Coh; an rAb.(Coh)x; an rAb.(Doc)x; an rAb.(Coh.Doc)x; or an rAb.(Coh)x(Doc)x; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- The present invention also includes a vector that includes a nucleic acid encoding an antigen specific domain and one or more domains that comprise one half of a cohesin-dockerin binding pair, a one half of a cohesin-dockerin binding pair with a protein molecule to be carried and combinations thereof. The one half of a cohesin-dockerin binding pair, a one half of a cohesin-dockerin binding pair with a protein molecule to be carried and combinations thereof are under the control of the same promoter, different promoters, transcribed in-line, transcribed in opposite directions.
- The present invention also includes a host cell comprising a vector comprising a nucleic acid encoding an antigen specific domain and one or more domains and one half of a cohesin-dockerin binding pair.
- A method of making a modular rAb carrier by combining an antigen specific domain linked to one or more domains of one half of a cohesin-dockerin binding pair. The rAb is further defined as: an rAb.Doc; an rAb.Coh; an rAb.(Coh)x; an rAb.(Doc)x; an rAb.(Coh.Doc)x; or an rAb.(Coh)x(Doc)x; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. Examples of the rAb is complexed with a complementary half of a cohesion:dokerin pair bound to an antigen and is selected from: an rAb.Doc:Coh.antigen; an rAb.Coh:Doc.antigen; an rAb.(Coh)x:(Doc.antigen)x; an rAb.(Doc)x:(Coh.antigen)x; an rAb.(Coh.Doc)x:(Doc.antigen1)(Coh.antigen2); or an rAb.(Coh)x(Doc)x:(Doc.antigen1)x(Coh.antigen2)x; wherein x is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- The present invention may also be an immunotoxin that includes an rAb.Doc:Coh.toxin self-assembled conjugate, wherein the rAb is specific for a cell target. Examples of toxins include a radioactive isotope, metal, enzyme, botulin, tetanus, ricin, cholera, diphtheria, aflatoxins, perfringens toxin, mycotoxins, shigatoxin, staphylococcal enterotoxin B, T2, seguitoxin, saxitoxin, abrin, cyanoginosin, alphatoxin, tetrodotoxin, aconotoxin, snake venom and spider venom. Cell targets for the immunotoxin include diseased or infected cells. Examples of diseased cells for targeting include cancer cell for, e.g., hematological cancers such as leukemias and lymphomas, neurological tumors such as astrocytomas or glioblastomas, melanoma, breast cancer, lung cancer, head and neck cancer, gastrointestinal tumors such as gastric or colon cancer, liver cancer, pancreatic cancer, genitourinary tumors such cervix, uterus, ovarian cancer, vaginal cancer, testicular cancer, prostate cancer or penile cancer, bone tumors, vascular tumors, or cancers of the lip, nasopharynx, pharynx and oral cavity, esophagus, rectum, gall bladder, biliary tree, larynx, lung and bronchus, bladder, kidney, brain and other parts of the nervous system, thyroid, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma and leukemia. The immunotoxin may target pathogens directly, e.g., bacteria, a protozoan, a helminth, a virally-infected cell or a fungus.
- The present invention also includes a method for protein purification by separating a cohesin or dockerin fusion protein by interacting the fusion protein with a rAb that is conjugated to the complementary cohesin or dockerin bound to a substrate. The present invention may also use the cohesin as a fusion partner for toxins for conferring beneficial biochemical properties favoring ready purification of active cohesin.toxin fusion protein. The present invention may also use the anti-DC rAb.Doc to target DC for therapeutic applications where ablating DC. Therapeutic applications include, e.g., transplantation, autoimmune disease, infectious disease or cancer. The invention also includes an anti-DC-SIGN/L antibody provided in an amount that is sufficient to enhance the survival of dendritic cells, wherein the antibody matures and activates the dendritic cells for immunization. The antibody may target cells in vivo, e.g., dendritic cells as an adjuvant in vaccines.
- Also invented is a bivalent and multivalent (rAb1.Doc:Coh.rAb2) self-assembled conjugates as therapeutic, diagnostic, and industrial agents. Alternatively, the invention is a bivalent and multivalent (rAb.Doc:Coh.cytokine), (rAb.Coh:Doc.cytokine) or (cytokine1.Coh:cytokine2.Doc) self-assembled conjugates as therapeutic, cell proliferation or maturing agents. The modular rAbs carrier may be made by method that includes screening one or more multivalent rAb and/or rAb.cytokine and/or cytokine.cytokine combinations that are capable of specifically binding to a target cell and delivering the cytokine such that it exerts its effect on the target cell. Cytokines for use with the present invention include: interleukins, transforming growth factors (TGFs), fibroblast growth factors (FGFs), platelet derived growth factors (PDGFs), epidermal growth factors (EGFs), connective tissue activated peptides (CTAPs), osteogenic factors, and biologically active analogs, fragments, and derivatives of such growth factors, B/T-cell differentiation factors, B/T-cell growth factors, mitogenic cytokines, chemotactic cytokines, colony stimulating factors, angiogenesis factors, IFN-α, IFN-β, IFN-γ, IL1, IL2, IL3, IL4, IL5, IL6, IL7, IL8, IL9, IL10, IL11, IL12, IL13, IL14, Il15, IL16, IL17, IL 18, etc., leptin, myostatin, macrophage stimulating protein, platelet-derived growth factor, TNF-α, TNF-β, NGF, CD40L, CD137L/4-1BBL, human lymphotoxin-β, G-CSF, M-CSF, GM-CSF, PDGF, IL-1α, IL1-β, IP-10, PF4, GRO, 9E3, erythropoietin, endostatin, angiostatin, VEGF, transforming growth factor (TGF) supergene family include the beta transforming growth factors (for example TGF-β1, TGF-β2, TGF-β3); bone morphogenetic proteins (for example, BMP-1, BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP-7, BMP-8, BMP-9); heparin-binding growth factors (fibroblast growth factor (FGF), epidermal growth factor (EGF), platelet-derived growth factor (PDGF), insulin-like growth factor (IGF)); Inhibins (for example, Inhibin A, Inhibin B); growth differentiating factors (for example, GDF-1); and Activins (for example, Activin A, Activin B, Activin AB).
- For a more complete understanding of the features and advantages of the present invention, reference is now made to the detailed description of the invention along with the accompanying figures and in which:
-
FIG. 1 compares the prior art (top portion) with an example of the multiple antigens targeted in a complex simultaneously with the same engineered humanized mAb (MATCHMAB) (bottom portion). -
FIG. 2 shows the use of the present invention to form Bi-specific mAbs. -
FIG. 3 shows Protein G affinity purified secreted rAb proteins analyzed by reducing SDS.PAGE and Coomassie Brilliant Blue staining. Lanes are from left to right. -
FIGS. 4A and 4B show the measurement by anti-human IgFc ELISA of levels of secretion of various rAb.fusion proteins. -
FIG. 5 shows the measurement by anti-human IgFc ELISA (HRP activity) and LOX-1.alkaline phoshatase binding (AP activity) of secreted anti-LOX1—15C4 rAb.(blue symbols) and anti-LOX1—15C4.doc rAb (red symbols) proteins. -
FIG. 6 shows that when co-transfected with a mIgG kappa expression plasmid, rAB-pCMV(mIgG2bH-Dockerin) plasmid directs the efficient secretion of rAB-mIgG2b.Dockerin fusion protein. -
FIGS. 7A and 7B show that the secreted coh.alkaline phosphatase (coh.AP) but not AP binds efficiently and specifically to rAb.Doc immobilized on plastic. -
FIGS. 8A and 8B shows various dilutions of a supernatant containing secreted G.AP bound to immobilized mIgG2a and mIgG2b, but not rAb.doc, while coh.AP bound rAb.doc specifically. -
FIG. 9 shows the differential stability of complexes between a fixed amount of proG.AP or coh.AP or coh2.AP (0.1 ug) and immobilized mIgG2b or rAb.doc (0.25 ug) assembled by incubation for 1 hr in a micro-titre plate. -
FIG. 10 shows the differential stability in human serum of complexes between a fixed amount of proG.AP or coh.AP (0.1 ug) and immobilized mIgG2b or rAb.doc (0.25 ug) were assembled by incubation for 1 hr in a micro-titre plate. -
FIG. 11 is a gel that shows the reduced vs. non-reduced SDS.PAGE analysis of rAb.doc:Coh2.AP complexes produced by sequential application of rAb.doc supernatant and coh.AP supernatant to the same protein G affinity column. -
FIG. 12 is a non-reduced SDS.PAGE analysis of rAb.doc:Coh.Flu HA5-1 complexes produced by sequential application of rAb.doc supernatant and coh.Flu HA5-1 supernatant to the same protein G affinity column. -
FIG. 13 shows that anti-DC_rAb.doc:coh.Flu M1 complex formed by mixing the individual purified components was effective in vitro in expanding Flu M1-specific T cells. -
FIG. 14 shows that Anti-DC_rAb.doc:coh.Flu M1 but not mIgG2b.doc:coh.Flu M1 complexes formed by mixing the individual purified components was effective in vitro in expanding Flu M1-specific T cells. -
FIG. 15 shows CD34+ human DC were sorted into CD1a+ and CD14+ subtypes and cultured with and without 3 nM Anti-DC_rAb.Flu M1 PEP or Anti-DC_rAb. -
FIG. 16 shows E. coli harboring expression plasmids directing the synthesis of coh.pep proteins were grown and induced for specific protein production. Cells were harvested and broken by sonication. -
FIG. 17 shows that the DCIR.Doc rAb alone had no effect upon the survival of DCs, but DC-SIGN/L.Doc rAb ehnaces their survival. -
FIG. 18 shows that Coh.PE38 alone slightly increase the number of 7-AAD scored apoptotic cells (from 22.1-29.8%), but when linked to DCIR or DC-SIGN/L.Doc rAbs, Coh.PE38 greatly enhanced the number of 7-AAD scored apoptotic cells. -
FIG. 19 shows the expression of anti-DC-SIGN/L and Anti-DC-ASPGR rAb.Coh and rAb.Doc were efficiently secreted. -
FIG. 20 shows the effect of IL-21 and Coh.IL-21 on the proliferation of human B cells. - While the making and using of various embodiments of the present invention are discussed in detail below, it should be appreciated that the present invention provides many applicable inventive concepts that can be embodied in a wide variety of specific contexts. The specific embodiments discussed herein are merely illustrative of specific ways to make and use the invention and do not delimit the scope of the invention.
- To facilitate the understanding of this invention, a number of terms are defined below. Terms defined herein have meanings as commonly understood by a person of ordinary skill in the areas relevant to the present invention. Terms such as “a”, “an” and “the” are not intended to refer to only a singular entity, but include the general class of which a specific example may be used for illustration. The terminology herein is used to describe specific embodiments of the invention, but their usage does not delimit the invention, except as outlined in the claims.
- At present, protein engineering technology enables the ready and controlled addition of an antigen (or different antigens to one of the chains) of a recombinant mAb (H or L, usually the C-terminus of H is often used). If different antigens or different antigen sets need to be linked to the mAb, then the mAb needs to be re-engineered, expressed, and purified as a different entity.
- The present invention provides for the complexing of multiple antigens or proteins (engineered, expressed, and purified independently from the primary mAb) in a controlled, multivariable fashion, to one single primary recombinant mAb. Presently, there are methods for engineering site-specific biotinylation sites that provide for the addition of different proteins (each engineered separately linked to streptavidin) to the one primary mAb. However, the present invention provides for addition to the primary mAb of multiple combinations, in fixed equimolar ratios and locations, of separately engineered proteins.
- As used herein, the term “modular rAb carrier” is used to describe a recombinant antibody system that has been engineered to provide the controlled modular addition of diverse antigens, activating proteins, or other antibodies to a single recombinant monoclonal antibody (mAb). The rAb may be a monoclonal antibody made using standard hybridoma techniques, recombinant antibody display, humanized monoclonal antibodies and the like. The modular rAb carrier can be used to, e.g., target (via one primary recombinant antibody against an internalizing receptor, e.g., a human dendritic cell receptor) multiple antigens and/or antigens and an activating cytokine to dendritic cells (DC). The modular rAb carrier may also be used to join two different recombinant mAbs end-to-end in a controlled and defined manner.
- The antigen binding portion of the “modular rAb carrier” may be one or more variable domains, one or more variable and the first constant domain, an Fab fragment, a Fab' fragment, an F(ab)2 fragment, and Fv fragment, and Fabc fragment and/or a Fab fragment with portions of the Fc domain to which the cognate modular binding portions are added to the amino acid sequence and/or bound. The antibody for use in the modular rAb carrier can be of any isotype or class, subclass or from any source (animal and/or recombinant).
- In one non-limiting example, the modular rAb carrier is engineered to have one or more modular cohesin-dockerin protein domains for making specific and defined protein complexes in the context of engineered recombinant mAbs. The mAb is a portion of a fusion protein that includes one or more modular cohesin-dockerin protein domains carboxy from the antigen binding domains of the mAb. The cohesin-dockerin protein domains may even be attached post-translationally, e.g., by using chemical cross-linkers and/or disulfide bonding.
- The modular rAb carrier will be used to carry a separate molecule, e.g., a peptide, protein, lipid, carbohydrate, nucleic acid (oligonucleotide, aptamer, vector with or without base or backbone modifications) or combinations thereof by binding that separate molecule to the complementary half of the cohesion:dockerin pair. For example, either the dockerin or cohesin made be made into a fusion protein or chemically bound to an antigen, a peptide, a protein, a toxin, a cytokine, an enzyme, a structural protein, an extracellular matrix protein, another antibody, a cell or fragments thereof. The modular rAb carrier may have one or more cohesin, dockerin or both cohesin and dockerin domains that allow the formation of a complex with one or more complementary cohesin/dockerin-molecules for delivery via the antigen recognition domain of the modular rAb carrier.
- The term “antigen” as used herein refers to a molecule that can initiate a humoral and/or cellular immune response in a recipient of the antigen. Antigen may be used in two different contexts with the present invention: as a target for the antibody or other antigen recognition domain of the rAb or as the molecule that is carried to and/or into a cell or target by the rAb as part of a dockerin/cohesin-molecule complement to the modular rAb carrier. The antigen is usually an agent that causes a disease for which a vaccination would be advantageous treatment. When the antigen is presented on MHC, the peptide is often about 8 to about 25 amino acids. Antigens include any type of biologic molecule, including, for example, simple intermediary metabolites, sugars, lipids and hormones as well as macromolecules such as complex carbohydrates, phospholipids, nucleic acids and proteins. Common categories of antigens include, but are not limited to, viral antigens, bacterial antigens, fungal antigens, protozoal and other parasitic antigens, tumor antigens, antigens involved in autoimmune disease, allergy and graft rejection, and other miscellaneous antigens.
- The modular rAb carrier is able to carry any number of active agents, e.g., antibiotics, anti-infective agents, antiviral agents, anti-tumoral agents, antipyretics, analgesics, anti-inflammatory agents, therapeutic agents for osteoporosis, enzymes, cytokines, anticoagulants, polysaccharides, collagen, cells, and combinations of two or more of the foregoing active agents. Examples of antibiotics for delivery using the present invention include, without limitation, tetracycline, aminoglycosides, penicillins, cephalosporins, sulfonamide drugs, chloramphenicol sodium succinate, erythromycin, vancomycin, lincomycin, clindamycin, nystatin, amphotericin B, amantidine, idoxuridine, p-amino salicyclic acid, isoniazid, rifampin, antinomycin D, mithramycin, daunomycin, adriamycin, bleomycin, vinblastine, vincristine, procarbazine, imidazole carboxamide, and the like.
- Examples of anti-tumor agents for delivery using the present invention include, without limitation, doxorubicin, Daunorubicin, taxol, methotrexate, and the like. Examples of antipyretics and analgesics include aspirin, Motrin®, Ibuprofen®, naprosyn, acetaminophen, and the like.
- Examples of anti-inflammatory agents for delivery using the present invention include, without limitation, include NSAIDS, aspirin, steroids, dexamethasone, hydrocortisone, prednisolone, Diclofenac Na, and the like.
- Examples of therapeutic agents for treating osteoporosis and other factors acting on bone and skeleton include for delivery using the present invention include, without limitation, calcium, alendronate, bone GLa peptide, parathyroid hormone and its active fragments, histone H4-related bone formation and proliferation peptide and mutations, derivatives and analogs thereof.
- Examples of enzymes and enzyme cofactors for delivery using the present invention include, without limitation, pancrease, L-asparaginase, hyaluronidase, chymotrypsin, trypsin, tPA, streptokinase, urokinase, pancreatin, collagenase, trypsinogen, chymotrypsinogen, plasminogen, streptokinase, adenyl cyclase, superoxide dismutase (SOD), and the like.
- Examples of cytokines for delivery using the present invention include, without limitation, interleukins, transforming growth factors (TGFs), fibroblast growth factors (FGFs), platelet derived growth factors (PDGFs), epidermal growth factors (EGFs), connective tissue activated peptides (CTAPs), osteogenic factors, and biologically active analogs, fragments, and derivatives of such growth factors. Cytokines may be B/T-cell differentiation factors, B/T-cell growth factors, mitogenic cytokines, chemotactic cytokines, colony stimulating factors, angiogenesis factors, IFN-α, IFN-β, IFN-γ, IL1, IL2, IL3, IL4, IL5, IL6, IL7, IL8, IL9, IL10, IL11, IL12, IL13, IL14, IL15, IL16, IL17, IL18, etc., leptin, myostatin, macrophage stimulating protein, platelet-derived growth factor, TNF-α, TNF-β, NGF, CD40L, CD137L/4-1BBL, human lymphotoxin-β, G-CSF, M-CSF, GM-CSF, PDGF, IL-1α, IL1-β, IP-10, PF4, GRO, 9E3, erythropoietin, endostatin, angiostatin, VEGF or any fragments or combinations thereof. Other cytokines include members of the transforming growth factor (TGF) supergene family include the beta transforming growth factors (for example TGF-β1, TGF-β2, TGF-β3); bone morphogenetic proteins (for example, BMP-1, BMP-2, BMP-3, BMP-4, BMP-5, BMP-6, BMP-7, BMP-8, BMP-9); heparin-binding growth factors (for example, fibroblast growth factor (FGF), epidermal growth factor (EGF), platelet-derived growth factor (PDGF), insulin-like growth factor (IGF)); Inhibins (for example, Inhibin A, Inhibin B); growth differentiating factors (for example, GDF-1); and Activins (for example, Activin A, Activin B, Activin AB).
- Examples of growth factors for delivery using the present invention include, without limitation, growth factors that can be isolated from native or natural sources, such as from mammalian cells, or can be prepared synthetically, such as by recombinant DNA techniques or by various chemical processes. In addition, analogs, fragments, or derivatives of these factors can be used, provided that they exhibit at least some of the biological activity of the native molecule. For example, analogs can be prepared by expression of genes altered by site-specific mutagenesis or other genetic engineering techniques.
- Examples of anticoagulants for delivery using the present invention include, without limitation, include warfarin, heparin, Hirudin, and the like. Examples of factors acting on the immune system include for delivery using the present invention include, without limitation, factors which control inflammation and malignant neoplasms and factors which attack infective microorganisms, such as chemotactic peptides and bradykinins.
- Examples of viral antigens and/or viral antigenic targets include, but are not limited to, e.g., retroviral antigens such as retroviral antigens from the human immunodeficiency virus (HIV) antigens such as gene products of the gag, pol, and env genes, the Nef protein, reverse transcriptase, and other HIV components; hepatitis viral antigens such as the S, M, and L proteins of hepatitis B virus, the pre-S antigen of hepatitis B virus, and other hepatitis, e.g., hepatitis A, B, and C, viral components such as hepatitis C viral RNA; influenza viral antigens such as hemagglutinin and neuraminidase and other influenza viral components; measles viral antigens such as the measles virus fusion protein and other measles virus components; rubella viral antigens such as proteins E1 and E2 and other rubella virus components; rotaviral antigens such as VP7sc and other rotaviral components; cytomegaloviral antigens such as envelope glycoprotein B and other cytomegaloviral antigen components; respiratory syncytial viral antigens such as the RSV fusion protein, the M2 protein and other respiratory syncytial viral antigen components; herpes simplex viral antigens such as immediate early proteins, glycoprotein D, and other herpes simplex viral antigen components; varicella zoster viral antigens such as gpI, gpII, and other varicella zoster viral antigen components; Japanese encephalitis viral antigens such as proteins E, M-E, M-E-NS1, NS1, NS1-NS2A, 80% E, and other Japanese encephalitis viral antigen components; rabies viral antigens such as rabies glycoprotein, rabies nucleoprotein and other rabies viral antigen components. See Fundamental Virology, Second Edition, eds. Fields, B. N. and Knipe, D. M. (Raven Press, New York, 1991) for additional examples of viral antigens.
- Antigens and/or antigenic targets that may be delivered using the rAb-DC/DC-antigen vaccines of the present invention include genes encoding antigens such as viral antigens, bacterial antigens, fungal antigens or parasitic antigens. Viruses include picornavirus; coronavirus, togavirus, flavirvirus, rhabdovirus, paramyxovirus, orthomyxovirus, bunyavirus, arenavirus, reovirus, retrovirus, papilomavirus, parvovirus, herpesvirus, poxvirus, hepadnavirus, and spongiform virus. Other viral targets include influenza,
herpes simplex virus - Bacterial antigens for use with the rAb vaccine disclosed herein include, but are not limited to, e.g., bacterial antigens such as pertussis toxin, filamentous hemagglutinin, pertactin, FIM2, FIM3, adenylate cyclase and other pertussis bacterial antigen components; diptheria bacterial antigens such as diptheria toxin or toxoid and other diptheria bacterial antigen components; tetanus bacterial antigens such as tetanus toxin or toxoid and other tetanus bacterial antigen components; streptococcal bacterial antigens such as M proteins and other streptococcal bacterial antigen components; gram-negative bacilli bacterial antigens such as lipopolysaccharides and other gram-negative bacterial antigen components, Mycobacterium tuberculosis bacterial antigens such as mycolic acid, heat shock protein 65 (HSP65), the 30 kDa major secreted protein, antigen 85A and other mycobacterial antigen components; Helicobacter pylori bacterial antigen components; pneumococcal bacterial antigens such as pneumolysin, pneumococcal capsular polysaccharides and other pneumococcal bacterial antigen components; haemophilus influenza bacterial antigens such as capsular polysaccharides and other haemophilus influenza bacterial antigen components; anthrax bacterial antigens such as anthrax protective antigen and other anthrax bacterial antigen components; rickettsiae bacterial antigens such as rompA and other rickettsiae bacterial antigen component. Also included with the bacterial antigens described herein are any other bacterial, mycobacterial, mycoplasmal, rickettsial, or chlamydial antigens. Partial or whole pathogens may also be: haemophilus influenza; Plasmodium falciparum; neisseria meningitidis; streptococcus pneumoniae; neisseria gonorrhoeae; salmonella serotype typhi; shigella; vibrio cholerae; Dengue Fever; Encephalitides; Japanese Encephalitis; lyme disease; Yersinia pestis; west nile virus; yellow fever; tularemia; hepatitis (viral; bacterial); RSV (respiratory syncytial virus);
HPIV 1 andHPIV 3; adenovirus; small pox; allergies and cancers. - Fungal antigens for use with compositions and methods of the invention include, but are not limited to, e.g., candida fungal antigen components; histoplasma fungal antigens such as heat shock protein 60 (HSP60) and other histoplasma fungal antigen components; cryptococcal fungal antigens such as capsular polysaccharides and other cryptococcal fungal antigen components; coccidiodes fungal antigens such as spherule antigens and other coccidiodes fungal antigen components; and tinea fungal antigens such as trichophytin and other coccidiodes fungal antigen components.
- Examples of protozoal and other parasitic antigens include, but are not limited to, e.g., plasmodium falciparum antigens such as merozoite surface antigens, sporozoite surface antigens, circumsporozoite antigens, gametocyte/gamete surface antigens, blood-stage antigen pf 155/RESA and other plasmodial antigen components; toxoplasma antigens such as SAG-1, p30 and other toxoplasmal antigen components; schistosomae antigens such as glutathione-S-transferase, paramyosin, and other schistosomal antigen components; leishmania major and other leishmaniae antigens such as gp63, lipophosphoglycan and its associated protein and other leishmanial antigen components; and trypanosoma cruzi antigens such as the 75-77 kDa antigen, the 56 kDa antigen and other trypanosomal antigen components.
- Target antigens on immune cell surfaces that can be targeted using the antigen recognition site of the antibody portion of the rAb of the present invention will generally be selected based on a number of factors, including: likelihood of internalization, level of immune cell specificity, type of immune cell targeted, level of immune cell maturity and/or activation and the like. Examples of cell surface markers for dendritic cells include, but are not limited to, MHC class I, MHC Class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD19, CD20, CD29, CD31, CD40, CD43, CD44, CD45, CD54, CD56, CD57, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40, BDCA-2, MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1, B7-2, IFN-y receptor and IL-2 receptor, ICAM-1, Fcγ receptor or other receptor relatively specifically expressed by antigen presenting cells. Examples of cell surface markers for antigen presenting cells include, but are not limited to, MHC class I, MHC Class II, CD1, CD2, CD3, CD4, CD8, CD11b, CD14, CD15, CD16, CD19, CD20, CD29, CD31, CD40,CD43, CD44, CD45, CD54, CD56, CD57, CD58, CD83, CD86, CMRF-44, CMRF-56, DCIR, DC-ASPGR, CLEC-6, CD40, BDCA-2, MARCO, DEC-205, mannose receptor, Langerin, DECTIN-1, B7-1, B7-2, IFN-γ receptor and IL-2 receptor, ICAM-1, Fcγ receptor or other receptor relatively specifically expressed by antigen presenting cells. Examples of cell surface markers for T cells include, but are not limited to, CD3, CD4, CD8, CD14, CD20, CD11b, CD16, CD45 and HLA-DR.
- Target antigens on cell surfaces for delivery includes those characteristic of tumor antigens typically will be derived from the cell surface, cytoplasm, nucleus, organelles and the like of cells of tumor tissue. Examples of tumor targets for the antibody portion of the present invention include, without limitation, hematological cancers such as leukemias and lymphomas, neurological tumors such as astrocytomas or glioblastomas, melanoma, breast cancer, lung cancer, head and neck cancer, gastrointestinal tumors such as gastric or colon cancer, liver cancer, pancreatic cancer, genitourinary tumors such cervix, uterus, ovarian cancer, vaginal cancer, testicular cancer, prostate cancer or penile cancer, bone tumors, vascular tumors, or cancers of the lip, nasopharynx, pharynx and oral cavity, esophagus, rectum, gall bladder, biliary tree, larynx, lung and bronchus, bladder, kidney, brain and other parts of the nervous system, thyroid, Hodgkin's disease, non-Hodgkin's lymphoma, multiple myeloma and leukemia.
- Examples of antigens that may be delivered alone or in combination to immune cells for antigen presentation using the present invention include tumor proteins, e.g., mutated oncogenes; viral proteins associated with tumors; and tumor mucins and glycolipids. The antigens may be viral proteins associated with tumors would be those from the classes of viruses noted above. Certain antigens may be characteristic of tumors (one subset being proteins not usually expressed by a tumor precursor cell), or may be a protein which is normally expressed in a tumor precursor cell, but having a mutation characteristic of a tumor. Other antigens include mutant variant(s) of the normal protein having an altered activity or subcellular distribution, e.g., mutations of genes giving rise to tumor antigens.
- Specific non-limiting examples of tumor antigens include: CEA, prostate specific antigen (PSA), HER-2/neu, BAGE, GAGE, MAGE 1-4, 6 and 12, MUC (Mucin) (e.g., MUC-1, MUC-2, etc.), GM2 and GD2 gangliosides, ras, myc, tyrosinase, MART (melanoma antigen), Pmel 17 (gp100), GnT-V intron V sequence (N-acetylglucoaminyltransferase V intron V sequence), Prostate Ca psm, PRAME (melanoma antigen), β-catenin, MUM-1-B (melanoma ubiquitous mutated gene product), GAGE (melanoma antigen) 1, BAGE (melanoma antigen) 2-10, c-ERB2 (Her2/neu), EBNA (Epstein-Barr Virus nuclear antigen) 1-6, gp75, human papilloma virus (HPV) E6 and E7, p53, lung resistance protein (LRP), Bcl-2, and Ki-67. In addition, the immunogenic molecule can be an autoantigen involved in the initiation and/or propagation of an autoimmune disease, the pathology of which is largely due to the activity of antibodies specific for a molecule expressed by the relevant target organ, tissue, or cells, e.g., SLE or MG. In such diseases, it can be desirable to direct an ongoing antibody-mediated (i.e., a Th2-type) immune response to the relevant autoantigen towards a cellular (i.e., a Th1-type) immune response. Alternatively, it can be desirable to prevent onset of or decrease the level of a Th2 response to the autoantigen in a subject not having, but who is suspected of being susceptible to, the relevant autoimmune disease by prophylactically inducing a Th1 response to the appropriate autoantigen. Autoantigens of interest include, without limitation: (a) with respect to SLE, the Smith protein, RNP ribonucleoprotein, and the SS-A and SS-B proteins; and (b) with respect to MG, the acetylcholine receptor. Examples of other miscellaneous antigens involved in one or more types of autoimmune response include, e.g., endogenous hormones such as luteinizing hormone, follicular stimulating hormone, testosterone, growth hormone, prolactin, and other hormones.
- Antigens involved in autoimmune diseases, allergy, and graft rejection can be used in the compositions and methods of the invention. For example, an antigen involved in any one or more of the following autoimmune diseases or disorders can be used in the present invention: diabetes, diabetes mellitus, arthritis (including rheumatoid arthritis, juvenile rheumatoid arthritis, osteoarthritis, psoriatic arthritis), multiple sclerosis, myasthenia gravis, systemic lupus erythematosis, autoimmune thyroiditis, dermatitis (including atopic dermatitis and eczematous dermatitis), psoriasis, Sjogren's Syndrome, including keratoconjunctivitis sicca secondary to Sjogren's Syndrome, alopecia areata, allergic responses due to arthropod bite reactions, Crohn's disease, aphthous ulcer, iritis, conjunctivitis, keratoconjunctivitis, ulcerative colitis, asthma, allergic asthma, cutaneous lupus erythematosus, scleroderma, vaginitis, proctitis, drug eruptions, leprosy reversal reactions, erythema nodosum leprosum, autoimmune uveitis, allergic encephalomyelitis, acute necrotizing hemorrhagic encephalopathy, idiopathic bilateral progressive sensorineural hearing loss, aplastic anemia, pure red cell anemia, idiopathic thrombocytopenia, polychondritis, Wegener's granulomatosis, chronic active hepatitis, Stevens-Johnson syndrome, idiopathic sprue, lichen planus, Crohn's disease, Graves ophthalmopathy, sarcoidosis, primary biliary cirrhosis, uveitis posterior, and interstitial lung fibrosis. Examples of antigens involved in autoimmune disease include glutamic acid decarboxylase 65 (GAD 65), native DNA, myelin basic protein, myelin proteolipid protein, acetylcholine receptor components, thyroglobulin, and the thyroid stimulating hormone (TSH) receptor. Examples of antigens involved in allergy include pollen antigens such as Japanese cedar pollen antigens, ragweed pollen antigens, rye grass pollen antigens, animal derived antigens such as dust mite antigens and feline antigens, histocompatiblity antigens, and penicillin and other therapeutic drugs. Examples of antigens involved in graft rejection include antigenic components of the graft to be transplanted into the graft recipient such as heart, lung, liver, pancreas, kidney, and neural graft components. The antigen may be an altered peptide ligand useful in treating an autoimmune disease.
- As used herein, the term “epitope(s)” refer to a peptide or protein antigen that includes a primary, secondary or tertiary structure similar to an epitope located within any of a number of pathogen polypeptides encoded by the pathogen DNA or RNA. The level of similarity will generally be to such a degree that monoclonal or polyclonal antibodies directed against such polypeptides will also bind to, react with, or otherwise recognize, the peptide or protein antigen. Various immunoassay methods may be employed in conjunction with such antibodies, such as, for example, Western blotting, ELISA, RIA, and the like, all of which are known to those of skill in the art. The identification of pathogen epitopes, and/or their functional equivalents, suitable for use in vaccines is part of the present invention. Once isolated and identified, one may readily obtain functional equivalents. For example, one may employ the methods of Hopp, as taught in U.S. Pat. No. 4,554,101, incorporated herein by reference, which teaches the identification and preparation of epitopes from amino acid sequences on the basis of hydrophilicity. The methods described in several other papers, and software programs based thereon, can also be used to identify epitopic core sequences (see, for example, Jameson and Wolf, 1988; Wolf et al., 1988; U.S. Pat. No. 4,554,101). The amino acid sequence of these “epitopic core sequences” may then be readily incorporated' into peptides, either through the application of peptide synthesis or recombinant technology.
- As used herein, the term “promoter” describes a control sequence that is a region of a nucleic acid sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors. The phrases “operatively positioned,” “operatively linked,” “under control,” and “under transcriptional control” mean that a promoter is in a correct functional location and/or orientation in relation to a nucleic acid sequence (i.e., ORF) to control transcriptional initiation and/or expression of that sequence. A promoter may or may not be used in conjunction with an “enhancer,” which refers to a cis-acting regulatory sequence involved in the, transcriptional activation of a nucleic acid sequence. A listing of promoters and/or enhancers that may be used with the present invention is described in, e.g., U.S. Pat. No. 6,410,241, relevant descriptions and tables incorporated herein by reference.
- As used herein, the terms “cell,” “cell line,” and “cell culture” may be used interchangeably. All of these terms also include their progeny, which is any and all subsequent generations, in vivo, ex vivo or in vitro. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations. In the context of expressing a heterologous nucleic acid sequence, “host cell” refers to a prokaryotic or eukaryotic cell, and it includes any transformable organism that is capable of expressing a heterologous gene encoded by a vector as delivered using the rAb protein vector of the present invention. A host cell can, and has been, used as a recipient for vectors. A host cell may be “transfected” or “transformed,” which refers to a process by which the exogenous nucleic acid expressing an antigen, as disclosed herein, is transferred or introduced into the host cell. A transformed cell includes the primary subject cell and its progeny.
- The preparation of vaccine compositions that includes the nucleic acids that encode antigens of the invention as the active ingredient, may be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to infection can also be prepared. The preparation may be emulsified, encapsulated in liposomes. The active immunogenic ingredients are often mixed with carriers which are pharmaceutically acceptable and compatible with the active ingredient.
- The term “pharmaceutically acceptable carrier” refers to a carrier that does not cause an allergic reaction or other untoward effect in subjects to whom it is administered. Suitable pharmaceutically acceptable carriers include, for example, one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, or the like and combinations thereof. In addition, if desired, the vaccine can contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and/or adjuvants which enhance the effectiveness of the vaccine. Examples of adjuvants that may be effective include but are not limited to: aluminum hydroxide, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine, MTP-PE and RIBI, which contains three components extracted from bacteria, monophosporyl lipid A, trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2% squalene/
Tween 80 emulsion. Other examples of adjuvants include DDA (dimethyldioctadecylammonium bromide), Freund's complete and incomplete adjuvants and QuilA. In addition, immune modulating substances such as lymphokines (e.g., IFN-γ, IL-2 and IL-12) or synthetic IFN-γ inducers such as poly I:C can be used in combination with adjuvants described herein. - Pharmaceutical products that may include a naked polynucleotide with a single or multiple copies of the specific nucleotide sequences that bind to specific DNA-binding sites of the apolipoproteins present on plasma lipoproteins as described in the current invention. The polynucleotide may encode a biologically active peptide, antisense RNA, or ribozyme and will be provided in a physiologically acceptable administrable form. Another pharmaceutical product that may spring from the current invention may include a highly purified plasma lipoprotein fraction, isolated according to the methodology, described herein from either the patients blood or other source, and a polynucleotide containing single or multiple copies of the specific nucleotide sequences that bind to specific DNA-binding sites of the apolipoproteins present on plasma lipoproteins, prebound to the purified lipoprotein fraction in a physiologically acceptable, administrable form.
- Yet another pharmaceutical product may include a highly purified plasma lipoprotein fraction which contains recombinant apolipoprotein fragments containing single or multiple copies of specific DNA-binding motifs, prebound to a polynucleotide containing single or multiple copies of the specific nucleotide sequences, in a physiologically acceptable administrable form. Yet another pharmaceutical product may include a highly purified plasma lipoprotein fraction which contains recombinant apolipoprotein fragments containing single or multiple copies of specific DNA-binding motifs, prebound to a polynucleotide containing single or multiple copies of the specific nucleotide sequences, in a physiologically acceptable administrable form.
- The dosage to be administered depends to a great extent on the body weight and physical condition of the subject being treated as well as the route of administration and frequency of treatment. A pharmaceutical composition that includes the naked polynucleotide prebound to a highly purified lipoprotein fraction may be administered in amounts ranging from 1 μg to 1 mg polynucleotide and 1 μg to 100 mg protein.
- Administration of the therapeutic virus particle to a patient will follow general protocols for the administration of chemotherapeutics, taking into account the toxicity, if any, of the vector. It is anticipated that the treatment cycles would be repeated as necessary. It also is contemplated that various standard therapies, as well as surgical intervention, may be applied in combination with the described gene therapy.
- Where clinical application of a gene therapy is contemplated, it will be necessary to prepare the complex as a pharmaceutical composition appropriate for the intended application. Generally this will entail preparing a pharmaceutical composition that is essentially free of pyrogens, as well as any other impurities that could be harmful to humans or animals. One also will generally desire to employ appropriate salts and buffers to render the complex stable and allow for complex uptake by target cells.
- Aqueous compositions of the present invention may include an effective amount of the compound, dissolved or dispersed in a pharmaceutically acceptable carrier or aqueous medium. Such compositions can also be referred to as inocula. The use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients also can be incorporated into the compositions. The compositions of the present invention may include classic pharmaceutical preparations. Dispersions also can be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
- Disease States. Depending on the particular disease to be treated, administration of therapeutic compositions according to the present invention will be via any common route so long as the target tissue is available via that route in order to maximize the delivery of antigen to a site for maximum (or in some cases minimum) immune response. Administration will generally be by orthotopic, intradermal, subcutaneous, intramuscular, intraperitoneal or intravenous injection. Other areas for delivery include: oral, nasal, buccal, rectal, vaginal or topical. Topical administration would be particularly advantageous for treatment of skin cancers. Such compositions would normally be administered as pharmaceutically acceptable compositions that include physiologically acceptable carriers, buffers or other excipients.
- Vaccine or treatment compositions of the invention may be administered parenterally, by injection, for example, either subcutaneously or intramuscularly. Additional formulations which are suitable for other modes of administration include suppositories, and in some cases, oral formulations or formulations suitable for distribution as aerosols. In the case of the oral formulations, the manipulation of T-cell subsets employing adjuvants, antigen packaging, or the addition of individual cytokines to various formulation that result in improved oral vaccines with optimized immune responses. For suppositories, traditional binders and carriers may include, for example, polyalkylene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1%-2%. Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain 10%-95% of active ingredient, preferably 25-70%.
- The antigen encoding nucleic acids of the invention may be formulated into the vaccine or treatment compositions as neutral or salt forms. Pharmaceutically acceptable salts include the acid addition salts (formed with free amino groups of the peptide) and which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or with organic acids such as acetic, oxalic, tartaric, maleic, and the like. Salts formed with the free carboxyl groups can also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
- Vaccine or treatment compositions are administered in a manner compatible with the dosage formulation, and in such amount as will be prophylactically and/or therapeutically effective. The quantity to be administered depends on the subject to be treated, including, e.g., capacity of the subject's immune system to synthesize antibodies, and the degree of protection or treatment desired. Suitable dosage ranges are of the order of several hundred micrograms active ingredient per vaccination with a range from about 0.1 mg to 1000 mg, such as in the range from about 1 mg to 300 mg, and preferably in the range from about 10 mg to 50 mg. Suitable regiments for initial administration and booster shots are also variable but are typified by an initial administration followed by subsequent inoculations or other administrations. Precise amounts of active ingredient required to be administered depend on the judgment of the practitioner and may be peculiar to each subject. It will be apparent to those of skill in the art that the therapeutically effective amount of nucleic acid molecule or fusion polypeptides of this invention will depend, inter alia, upon the administration schedule, the unit dose of antigen administered, whether the nucleic acid molecule or fusion polypeptide is administered in combination with other therapeutic agents, the immune status and health of the recipient, and the therapeutic activity of the particular nucleic acid molecule or fusion polypeptide.
- The compositions can be given in a single dose schedule or in a multiple dose schedule. A multiple dose schedule is one in which a primary course of vaccination may include, e.g., 1-10 separate doses, followed by other doses given at subsequent time intervals required to maintain and or reinforce the immune response, for example, at 1-4 months for a second dose, and if needed, a subsequent dose(s) after several months. Periodic boosters at intervals of 1-5 years, usually 3 years, are desirable to maintain the desired levels of protective immunity. The course of the immunization can be followed by in vitro proliferation assays of peripheral blood lymphocytes (PBLs) co-cultured with ESAT6 or ST-CF, and by measuring the levels of IFN-γ released from the primed lymphocytes. The assays may be performed using conventional labels, such as radionuclides, enzymes, fluorescent labels and the like. These techniques are known to one skilled in the art and can be found in U.S. Pat. Nos. 3,791,932, 4,174,384 and 3,949,064, relevant portions incorporated by reference.
- The modular rAb carrier and/or conjugated rAb carrier-(cohesion/dockerin and/or dockerin-cohesin)-antigen complex (rAb-DC/DC-antigen vaccine) may be provided in one or more “unit doses” depending on whether the nucleic acid vectors are used, the final purified proteins, or the final vaccine form is used. Unit dose is defined as containing a predetermined-quantity of the therapeutic composition calculated to produce the desired responses in association with its administration, i.e., the appropriate route and treatment regimen. The quantity to be administered, and the particular route and formulation, are within the skill of those in the clinical arts. The subject to be treated may also be evaluated, in particular, the state of the subject's immune system and the protection desired. A unit dose need not be administered as a single injection but may include continuous infusion over a set period of time. Unit dose of the present invention may conveniently may be described in terms of DNA/kg (or protein/Kg) body weight, with ranges between about 0.05, 0.10, 0.15, 0.20, 0.25, 0.5, 1, 10, 50, 100, 1,000 or more mg/DNA or protein/kg body weight are administered. Likewise the amount of rAb-DC/DC-antigen vaccine delivered can vary from about 0.2 to about 8.0 mg/kg body weight. Thus, in particular embodiments, 0.4 mg, 0.5 mg, 0.8 mg, 1.0 mg, 1.5 mg, 2.0 mg, 2.5 mg, 3.0 mg, 4.0 mg, 5.0 mg, 5.5 mg, 6.0 mg, 6.5 mg, 7.0 mg and 7.5 mg of the vaccine may be delivered to an individual in vivo. The dosage of rAb-DC/DC-antigen vaccine to be administered depends to a great extent on the weight and physical condition of the subject being treated as well as the route of administration and the frequency of treatment. A pharmaceutical composition that includes a naked polynucleotide prebound to a liposomal or viral delivery vector may be administered in amounts ranging from 1 μg to 1 mg polynucleotide to 1 μg to 100 mg protein. Thus, particular compositions may include between about 1 μg, 5 μg, 10 μg, 20 μg, 30 μg, 40 μg, 50 μg, 60 μg, 70 μg, 80 μg, 100 μg, 150 μg, 200 μg, 250 μg, 500 μg, 600 μg, 700 μg, 800 μg, 900 μg or 1,000 μg polynucleotide or protein that is bound independently to 1 μg, 5 μg, 10 μg, 20 μg, 3.0 μg, 40
μg 50 μg, 60 μg, 70 μg, 80 μg, 100 μg, 150 μg, 200 μg, 250 μg, 500 μg, 600 μg, 700 μg, 800 μg, 900 μg, 1 mg, 1.5 mg, 5 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 80 mg, 90 mg or 100 mg vector. - The present invention was tested in an in vitro cellular system that measures immune stimulation of human Flu-specific T cells by dendritic cells to which Flu antigen has been targeted. The results shown herein demonstrate the specific expansion of such antigen specific cells at doses of the antigen which are by themselves ineffective in this system.
- The present invention may also be used to make a modular rAb carrier that is, e.g., a recombinant humanized mAb (directed to a specific human dendritic cell receptor) complexed with protective antigens from Ricin, Anthrax toxin, and Staphylococcus B enterotoxin. The potential market for this entity is vaccination of all military personel and stored vaccine held in reserve to administer to large population centers in response to any biothreat related to these agents. The invention has broad application to the design of vaccines in general, both for human and animal use. Industries of interest is pharmaceutical and biotechnology
- One commercial application of the invention is a recombinant humanized mAb (directed to the specific human dendritic cell receptor DCIR) fused through the Ab heavy chain to antigens known or suspected to encode protective antigens. These include as examples for vaccination against various agents—hemagglutinins from Influenza H5N1; HIV gag from attenuated toxins from Ricin, Anthrax toxin, and Staphylococcus B enterotoxin; ‘strings’ of antigenic peptides from melanona anigens, etc. The potential market for this entity is preventative or therapeutic vaccination of at risk or infected people. The invention has broad application for vaccination against many diseases and cancers, both for human and animal use. Industries of interest are pharmaceutical and biotechnology. In addition, this invention has implications beyond anti-DCIR application since it describes a method to identify particularly favorable sequences,to enhance secretion of recombinant antibodies.
- The application of anti-DCIR combining regions for making engineered recombinant monoclonal antibodies fused to antigens as potent therapeutic or preventative vaccination agents. Use of different V-region sequences against the same combining specificity to find those most compatible with efficient expression of a H chain C-terminal linked antigen or other protein sequence.
- One type of therapeutic (in this case, vaccination) entity envisioned is a humanized DC-targeting mAb-antigen fusion protein, where the antibody variable region specificity is directed against an internalizing human dendritic cell receptor. The present state-of-the art is to engineer the fusion of the desired antigen to the C-terminus of the mAb H chain. This paradigm obviously allows different antigens (A1, A2, A3) to be engineered to the same proven targeting mAb backbone (Y in the figure below), thus extending the utility of the one mAb to immunizing against different pathogenic agents. This concept can be further extended by engineering, e.g., the A1, A2, A3 coding regions end-to-end fused to the IgGFc C-terminal coding region.
- The present invention disclosed a new paradigm for linking the antigen to the targeting mAb that extends the concept for the first time to multiple antigens targeted in a complex simultaneously with the same engineered humanized mAb (MATCHMAB).
-
FIG. 1 compares the prior art (top portion) with an example of the multiple antigens targeted in a complex simultaneously with the same engineered humanized mAb (MATCHMAB) (bottom portion). Y represents the humanized anti-DC targeting mAb; A1, A2, A3 are independent protective antigens, or any other desired protein domains; C1, C2, C2 are specific high affinity capture domains for, respectively, docking domains D1, D2. D3; and DnAn are the corresponding docking-antigen fusion proteins. Note that the various domains are not drawn to scale. The mAb itself is ˜150 kDa, C is ˜17 Da, D is ˜8 kDa and A varies, but is usually >20 kDa). - The MATCHMAB is based on using cellulosome-assembly cohesin-dockerin sequences to form modular non-covalent targeting mAb-antigen complexes. The relatively small and specific cohesin-dockerin protein-protein interaction domains can allow simple customized formulation of targeting mAb-antigen complexes. Thus, a single manufactured humanized mAb (in the above notation: Y.C1.C2.C3.Cn) can be use as the basis of delivering multiple antigens in various, yet strictly defined, combinations.
- Example of sequence encoding C1.C2.C3.Cn is taken from the public sequence >gi|50656899|gb|AAT79550.1| of cellulosomal anchoring scaffoldin B precursor (Bacteroides cellulosolvens). Below with blue showing the leader secretion sequence and yellow and grey highlighting various cohesin domains. Red regions are linkers spacing some of the cohesin domains.
- The cohesin domains (C) interact with small domains (e.g., 56 residues) called dockerins (D). These are Ca++ containing structures with two-fold symmetry and they can bind to a cognate cohesin with various affinities (e.g., 6E6 M, 2E7M). Affinities between dockerin and multiple cohesins (as found on scaffoldins) can be much higher (e.g., >E9 M). The interaction is non-covalent and is well defined (by structure analysis) for at least one C-D pair. Dockerins are designed to be domains linked to different domain (enzyme in nature), and cohesions are designed to function in linear arrays (either directly end-to-end, or joined by flexible PT-rich linkers of various sizes (e.g., 12, 17, 25, 28, 36). It is known that a particular dockerin can have specificity for a particular cohesin (e.g., a C-D pair from one bacterial species may not be interchangeable with a C-D pair from a different species). This feature makes it is possible to ensure the specific and precise interaction of various D-antigen fusion proteins with an engineered mAb containing cohesin domains of various specificities.
- In practice, this invention includes adapting C-D pairs known from the literature, newly gleamed from nature, or developed with new specificities using phage display technology. The latter technology can also be used to enhance (‘mature’) the affinity of a C-D interaction, should this be desired. Also, engineering cysteine residues at opposing faces of the C-D interaction (based on modeling from the published C-D structures) could be used to make a covalent bond between C-D to strengthen the interaction. Furthermore, the dimeric nature of the mAb (and therefore the linked C-domains) can be used to advantage for affinity enhancement purposes. In this embodiment, e.g., the D-antigen fusion protein is engineered either with a second identical dockerin domain (D-antigen-D, or D-D-antigen), or with a homodimerization domain. This configuration, provided the linkers between domains were not constraining, will result in the preferred simultaneous binding of both D domains to the same mAb, with greatly enhanced stability compared to the single interaction.
- Based on the crystal structure of the cohesin-dockerin complex (e.g., see PNAS 2003, 13809-13814, Cellulosome assembly revealed by the crystal structure of the cohesin-dockerin complex. Ana L. Carvalho *, Fernando M. V. Dias, José A. M. Prates, Tibor Nagy, Harry J. Gilbert, Gideon J. Davies, Luis M. A. Ferreira, Maria J. Romão and Carlos M. G. A. Fonte), it is apparent that one embodiment is an antigen-dockerin fusion proteins (i.e., antigen fused to the N-terminus of a dockerin). However, both from the structure and from the nature of cohesin domain organization within scaffoldins, it is apparent that cohesions can be fused end-to-end, even without spacer sequences. Furthermore, it is apparent that well-described techniques are available to engineer miniaturized versions of the cohesin and dockerin domains (see for example, Proc. Natl. Acad. Sci. USA Vol. 94, pp. 10080-10085, September 1997. Structural mimicry of a native protein by a minimized binding domain. Melissa A. Starovasnik, Andrew C. Braisted, And James A. Wells).
- It is recognized herein that the linker sequences have a propensity for O-linked glycosylation resulting from ST richness. Also, both the C and D domains can have potential N-linked sites. These features can be advantageous in enhancing the solubility of the mammalian cell-expressed engineered mAb through decoration with carbohydrates. Of course, the consequences of glycosylation of the C domains needs to be check by function (binding to the cognate D), and if needed rectified by site directed mutagenesis. An attractive feature of this invention is that D-A can be expressed in whatever system is known to be best. For example, the tumor antigen MART1 is a membrane protein and is best prepared in high yield via E. coli inclusion bodies. Schema using antigens directly fused to the mAb are restricted to antigens that are compatible with mammalian-cell expression.
- Another embodiment of the invention is the use of the D-C interaction to make bi-specific mAbs joined tail-to-tail.
FIG. 2 shows the use of the present invention to form Bi-specific mAbs. mAb1 (black) is expressed with C-terminal C1 and mAb2 (magenta) is expressed with C-terminal D1. Mixing equimolar mAb1 and mAb2 will result in a bi-specific 1:1 complex. Note that, since each mAb molecule contains two molar equivalents of C or D (the mAb is itself a dimeric structure), the bi-specific mAb will be greatly stabilized by two concurrent C-D interactions. Especially at lower (mAb), this will be the most stable configuration. - Example 2 shows that particular cohesin and dockerin domains can be sucessfully and efficiently secreted from mammalian cells as fusion proteins while maintaining the specific and high affinity cohesin-dockerin protein-protein interaction. While the extensive cohesin-dockerin literature teaches the expectation that such fusion proteins should have this functionality, it does not describe production of such fusion proteins in mammalian secretion systems. The state of scientific knowledge does not allow the prediction of the discovery since the rules (other than features such as signal peptide) for successful secretion are not fully established. Furthermore, the cohesin linker regions are known to be glycosylated in their native bacteria, and the cohesin and dockerin domains contain predicted glycosylation sites. While this may actually favor secretion from mammalian cells, it is unclear if ‘unnatural’ glyosylation will perturb the cohesis-dockerin interaction.
- While cohesin-dockerin interaction for various commercial applications has been published, the present invention is based on a previously unrealized utility for this interaction built around assembling specific protein complexes unrelated to the envisioned controlled assembly enzyme applications.
- The invention includes the use of all cohesin-dockerin sequences from diverse cellulose degrading microbes, but describes the application of specific cohesin and dockerin and linker sequences from the microbe Clostridium thermocellum. For example, the sequence described in Table 1 encodes the H chain of a human IgG4 linked at the C-terminal codon to a Clostridium thermocellum dockerin sequence (called rAb.doc). Other embodiments of rAb.doc proteins are described similarly in Table 2 and these are engineered by simply transferring the dockerin coding region as a DNA fragment to vectors encoding the different H chain entities.
- TABLE 1 shows the nucleic acid and amino acid sequences for rAB-pIRES2(hIgG4H-Dockerin) or C52. DNA (entire coding region) and amino acid sequence (the predicted secreted product) of human IgG4H.doc fusion protein is shown below. The dockerin domain (taken from Clostridium thermocellum celD is highlighted in yellow and the H chain and dockerin joining sequence is underlined. The highly predicted N-linked glycosylation site within the dockerin domain is highlighted in red.
-
TABLE 1 rAB-pIRES2 (hIgG4H-Dockerin) or C52. (SEQ ID NO.: 2) ATGGACCTCCTGTGCAAGAACATGAAGCACCTGTGGTTCTTCCTCC TGCTGGTGGCGGCTCCCAGATGGGTCCTGTCCCGGCTGCAGCTGCA GGAGTCGGGCCCAGGCCTGCTGAAGCCTTCGGTGACCCTGTCCCTC ACCTGCACTGTCTCGGGTGACTCCGTCGCCAGTAGTTCTTATTACT GGGGCTGGGTCCGTCAGCCCCCAGGGAAGGGACTCGAGTGGATAGG GACTATCAATTTTAGTGGCAATATGTATTATAGTCCGTCCCTCAGG AGTCGAGTGACCATGTCGGCAGACATGTCCGAGAACTCCTTCTATC TGAAATTGGACTCTGTGACCGCAGCAGACACGGCCGTCTATTATTG TGCGGCAGGACACCTCGTTATGGGATTTGGGGCCCACTGGGGACAG GGAAAACTGGTCTCCGTCTCTCCAGCTTCCACCAAGGGCCCATCCG TCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCCGAGAGCACAGC CGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACG GTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCC CGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGT GACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGCAAC GTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGT CCAAATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGTTCGA AGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACT CTCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACG TGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGG CGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTC AACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGG ACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGG CCTCCCGTCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAG CCCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAGGAGA TGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTA CCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAG AACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCT TCTTCCTCTACAGCAGGCTAACCGTGGACAAGAGCAGGTGGCAGGA GGGGAATGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAAC CACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGTAAAGCTAGCA ATTCTCCTCAAAATGAAGTACTGTACGGAGATGTGAATGATGACGG AAAAGTAAACTCCACTGACTTGACTTTGTTAAAAAGATATGTTCTT AAAGCCGTCTCAACTCTCCCTTCTTCCAAAGCTGAAAAGAACGCAG ATGTAAATCGTGACGGAAGAGTTAATTCCAGTGATGTCACAATACT TTCAAGATATTTGATAAGGGTAATCGAGAAATTACCAATATAA (SEQ ID NO.: 3) RLQLQESGPGLLKPSVTLSLTCTVSGDSVASSSYYWGWVRQPPGKG LEWIGTINFSGNMYYSPSLRSRVTMSADMSENSFYLKLDSVTAADT AVYYCAAGHLVMGFGAHWGQGKLVSVSPASTKGPSVFPLAPCSRST SESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS LSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCP APEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFN WYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCK VSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDK SRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKASNSPQNEVLYGD VNDDGKVNSTDLTLLKRYVLKAVSTLPSSKAEKNADVNRDGRV DVTILSRYLIRVIEKLPI - TABLE 2 shows the nucleic acid and amino acid sequences for rAB-pIRES2(mAnti-DCIR2C9H-LV-hIgG4H-C-Dockerin) or C82. DNA (entire coding region) and amino acid sequence (the predicted secreted product) is shown below. The dockerin domain is highlighted in yellow and the H chain and dockerin joining sequence is underlined. The IgG variable region is highlighted in blue. The highly predicted N-linked glycosylation site within the dockerin domain is highlighted in red.
-
TABLE 2 rAB-pIRES2 (mAnti-DCIR2C9H-LV-hIgG4H-C-Dockerin) or C82. (SEQ ID NO.: 4) ATGAAATGCAGCTGGGTCATCTTCTTCCTGATGGCAGTGGTTACAGG GGTCAATTCAGAGGTTCAGCTGCAGCAGTCTGGGGCTGAGCTTGTGA GGCCAGGGGCCTTAGTCAAGTTGTCCTGCAAAGCTTCTGGCTTCAAC ATTAATGACTACTATATCCACTGGGTGAAGCAGCGGCCTGAACAGGG CCTGGAGCGGATTGGATGGATTGATCCTGACAATGGTAATACTATAT ATGACCCGAAGTTCCAGGGCAAGGCCAGTATAACAGCAGACACATCC CCCAACACAGCCTACCTGCAGCTCAGCAGCCTGACATCTGAGGACAC TGCCGTCTATTACTGTGCTAGAACCCGATCTCCTATGGTTACGACGG GGTTTGTTTACTGGGGCCAAGGGACTGTGGTCACTGTCTCTGCAGCC AAAACGAAGGGCCCATCCGTCTTCCCCCTGGCGCCCTGCTCCAGGAG CACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGACTACT TCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGC GGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTC CCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGA CCTACACCTGCAACGTAGATCACAAGCCCAGCAACACCAAGGTGGAC AAGAGAGTTGAGTCCAAATATGGTCCCCCATGCCCACCCTGCCCAGC ACCTGAGTTCGAAGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAAC CCAAGGACACTCTCATGATGTCCCGGACCCCTGAGGTCACGTGCGTG GTGGTGGACGTGAGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTA CGTGGATGGCGTGGAGGTGCATAATGCCAAGACRAAGCCGCGGGAGG AGCAGTTCAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTG CACCAGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAA CAAAGGCCTCCCGTCCTCCATCGAGAAAACCATCTCCAAAGCCAAAG GGCAGCCCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAG GAGATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTT CTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGG AGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCC TTCTTCCTCTACAGCAGGCTAACCGTGGACAAGAGCAGGTGGCAGGA GGGGAATGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACC ACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGTAAAGCTAGCAAT TCTCCTCAAAATGAAGTACTGTACGGAGATGTGAATGATGACGGAAA AGTAAACTCCACTGACTTGACTTTGTTAAAAAGATATGTTCTTAAAG CCGTCTCAACTCTCCCTTCTTCCAAAGCTGAAAAGAACGCAGATGTA AATCGTGACGGAAGAGTTAATTCCAGTGATGTCACAATACTTTCAAG ATATTTGATAAGGGTAATCGAGAAATTACCAATATAA (SEQ ID NO.: 5) EVQLQQSGAELVRPGALVKLSCKASGFNINDYYIHWVKQRPEQGLER IGWIDPDNGNTIYDPKFQGKASITADTSPNTAYLQLSSLTSEDTAVY YCARTRSPMVTTGFVYWGQGTVVTVSAAKTKGPSVFPLAPCSRSTSE STAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSS VVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEF EGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDG VEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGL PSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNV FSCSVMHEALHNHYTQKSLSLSLGKASNSPQNEVLYGDVNDDGKVNS TDLTLLKRYVLKAVSTLPSSKAEKNADVNRDGRV VTILSRYLIR VIEKLPI. - TABLE 3 shows the nucleic acid and amino acid sequences for rAB-(mAnti-ASGPR—49C11—7H-SLAML-V-hIgG4H-C-Dockerin) or C153. DNA (entire coding region) and amino acid sequence (the predicted secreted product) is shown below. The dockerin domain is highlighted in yellow and the H chain and dockerin joining sequence is underlined. The IgG variable region is highlighted in blue. The highly predicted N-linked glycosylation site within the dockerin domain is highlighted in red.
-
TABLE 3 rAB-(mAnti-ASGPR_49C11_7H-SLAML-V- hIgG4H-C-Dockerin) or C153. (SEQ ID NO.: 6) ATGGACCCCAAAGGCTCCCTTTCCTGGAGAATACTTCTGTTTCTCTCC CTGGCTTTTGAGTTGTCGTACGGAGATGTGCAGCTTCAGGAGTCAGGA CCTGACCTGGTGAAACCTTCTCAGTCACTTTCACTCACCTGCACTGTC ACTGGCTACTCCATCACCAGTGGTTATAGCTGGCACTGGATCCGGCAG TTTCCAGGAAACAAACTGGAATGGATGGGCTACATACTCTTCAGTGGT AGCACTAACTACAACCCATCTCTGAAAAGTCGAATCTCTATCACTCGA GACACATCCAAGAACCAGTTCTTCCTGCAGTTGAATTCTGTGACTACT GAGGACACAGCCACATATTTCTGTGCAAGATCTAACTATGGTTCCTTT GCTTCCTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCAGCCAAAACA AAGGGCCCATCCGTCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCC GAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAA CCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCAC ACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGC GTGGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGC AACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAG TCCAAATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGTTCGAA GGGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACTCTC ATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACGTGAGC CAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGTGGAG GTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCAACAGCACG TACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAAC GGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCCGTCCTCC ATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAGCCACAG GTGTACACCCTGCCCCCATCCCAGGAGGAGATGACCAAGAACCAGGTC AGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATCGCCGTG GAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCT CCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAGGCTAACC GTGGACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCATGCTCCGTG ATGCATGAGGCTCTGCACAACCACTACACACAGAAGAGCCTCTCCCTG TCTCTGGGTAAAGCTAGCAATTCTCCTCAAAATGAAGTACTGTACGGA GATGTGAATGATGACGGAAAAGTAAACTCCACTGACTTGACTTTGTTA AAAAGATATGTTCTTAAAGCCGTCTCAACTCTCCCTTCTTCCAAAGCT GAAAAGAACGCAGATGTAAATCGTGACGGAAGAGTTAATTCCAGTGAT GTCACAATACTTTCAAGATATTTGATAAGGGTAATCGAGAAATTACCA ATATAA (SEQ ID NO.: 7) DVQLQESGPDLVKPSQSLSLTCTVTGYSITSGYSWHWIRQFPGNKLEW MGYILFSGSTNYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYFC ARSNYGSFASWGQGTLVTVSAAKTKGPSVFPLAPCSRSTSESTAALGC LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSS LGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKA KGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP ENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNH YTQKSLSLSLGKASNSPQNEVLYGDVNDDGKVNSTDLTLLKRYVLKAV STLPSSKAEKNADVNRDGRV VTILSRYLIRVIEKLPI - TABLE 4 shows the nucleic acid and amino acid sequences for rAB-pIRES2(mAnti-DC-SIGNL16E7H-LV-hIgG4H-C-Dockerin) or C92. DNA (entire coding region) and amino acid sequence (the predicted secreted product) is shown below. The dockerin domain is highlighted in yellow and the H chain and dockerin joining sequence is underlined. The IgG variable region is highlighted in blue. The highly predicted N-linked glycosylation site within the dockerin domain is highlighted in red.
-
TABLE 4 rAB-pIRES2 (mAnti-DC-SIGNL16E7H- LV-hIgG4H-C-Dockerin) or C92 (SEQ ID NO.: 8) ATGGAAAGGCACTGGATCTTTCTCTTCCTGTTTTCAGTAACTGCAGG TGTCCACTCCCAGGTCCAGCTTCAGCAGTCTGGGGCTGAGCTGGCAA AACCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTCTGGCTACACC TTTACTACCTACTGGATGCACTGGGTAAAACAGAGGCCTGGACAGGG TCTGGAATGGATTGGATACATTAATCCTATCACTGGTTATACTGAGT ACAATCAGAAGTTCAAGGACAAGGCCACCTTGACTGCAGACAAATCC TCCAGCACAGCCTACATGCAACTGAGCAGCCTGACATCTGAGGACTC TGCAGTCTATTACTGTGCAAGAGAGGGTTTAAGTGCTATGGACTATT GGGGTCAGGGAACCTCAGTCACCGTCACCTCAGCCAAAACAACGGGC CCATCCGTCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCCGAGAG CACAGCCGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGG TGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACC TTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGT GGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGCA ACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAG TCCAAATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGTTCGA AGGGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACTC TCATGATCTCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACGTG AGCCAGGAAGACCCCGAGGTCCAGTTCAACTGGTACGTGGATGGCGT GGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTTCAACA GCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGG CTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGGCCTCCC GTCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAG AGCCACAGGTGTACACCCTGCCCCCATCCCAGGAGGAGATGACCAAG AACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGA CATCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACA AGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTAC AGCAGGCTAACCGTGGACAAGAGCAGGTGGCAGGAGGGGAATGTCTT CTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACACAGA AGAGCCTCTCCCTGTCTCTGGGTAAAGCTAGCAATTCTCCTCAAAAT GAAGTACTGTACGGAGATGTGAATGATGACGGAAAAGTAAACTCCAC TGACTTGACTTTGTTAAAAAGATATGTTCTTAAAGCCGTCTCAACTC TCCCTTCTTCCAAAGCTGAAAAGAACGCAGATGTAAATCGTGACGGA AGAGTTAATTCCAGTGATGTCACAATACTTTCAAGATATTTGATAAG GGTAATCGAGAAATTACCAATATAA (SEQ ID NO.: 9) QVQLQQSGAELAKPGASVKMSCKASGYTFTTYWMHWVKQRPGQGLEW IGYINPITGYTEYNQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVY YCAREGLSAMDYWGQGTSVTVTSAKTTGPSVFPLAPCSRSTSESTAA LGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV PSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVH NAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSI EKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCS VMHEALHNHYTQKSLSLSLGKASNSPQNEVLYGDVNDDGKVNSTDLT LLKRYVLKAVSTLPSSKAEKNADVNRDGRV DVTILSRYLIRVIE KLPI - Mammalian expression plasmids encoding such rAb.doc IgG H chain proteins are created using standard molecular biology techniques and can be based on commercially available expression plasmid vectors such as pIRES2-DsRed2 (BD Biosciences). To produce secreted rAb.doc, mammalian cells are co-transfected with this expression plasmid and an expression plasmid encoding a complimentary IgG L chain (exemplified in Table 3). Standard protocols (such as the FreeStyle™ 293 Expression System, Invitrogen) are used as for mammalian cells, transfection reagents, and culture media. Transfected cells are cultured for 3-7 days and the culture supernatant is harvested by centrifugation, clarified by filtration, and the rAB.doc protein purified by Protein G affinity chromatography using protocols from the column manufacturer (GE Pharmacia).
-
FIG. 3 shows analysis of typical secreted rAb.doc products by reducing SDS.PAGE with staining by Coomassie Brilliant Blue. This analysis shows that the rAb.doc is efficiently produced as a secreted H+L chain dimer. Heterogeneity in the H chain likely reflects N-linked glycosylation at a highly predicted (Potential 0.6426, NetNGlyc 1.0 Server—Technical University of Denmark) site within the dockerin sequence. - TABLE 5 shows the nucleic acid and amino acid sequences for rAB-pIRES2(mAnti-DC-SIGNL16E7K-LV-hIgGK-C) or C73. DNA (entire coding region) and amino acid sequence (the predicted secreted product) of IgG Kappa protein fusing the V region from the mAnti-DC-SIGNL16E7 hybridoma (highlighted in blue)to a human C region (highlighted in yellow).
-
TABLE 5 rAB-pIRES2(mAnti-DC-SIGNL16E7K-LV-hIgGK-C) or C73. (SEQ ID NO.: 10) ATGCATCGCACCAGCATGGGCATCAAGATGGAGTCACAGATTCAGGCATTTGTATTCGTGTTTCTCTGGTTGTCTGGTGTTGGCG GAGACATTGTGATGACCCAGTCTCACAAATTCATGTCCACATCAGTAGGAGACAGGGTCAGCGTCACCTGCAAGGCCAGTCAGGA TGTGACTTCTGCTGTAGCCTGGTATCAACAAAAACCAGGGCAATCTCCTAAACTACTGATTTACTGGGCATCCACCCGGCACACT GGAGTCCCTGATCGCTTCACAGGCAGTGGATCTGGGACAGATTATACTCTCACCATCAGCAGTGGGCAGGCTGAAGACCTGGCAC TTTATTACTGTCACCAATATTATAGCGCTCCTCGGACGTTCGGTGGAGGCACCAAGCTCGAGATCAAACGAACTGTGGCTGCACC ATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCC AGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGG ACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTATGCCTGCGAAGTCACCCA TCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG (SEQ ID NO.: 11) DIVMTQSHKFMSTSVGDRVSVTCKASQDVTSAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTISSGQAEDLAL YYCHQYYSAPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC. -
FIG. 3 shows Protein G affinity purified secreted rAb proteins analyzed by reducing SDS.PAGE and Coomassie Brilliant Blue staining. Lanes are from left to right. - The invention enbodies the unanticipated presence and use of this glycosylation site that likely confers onto mammalian cell-secreted dockerin fusion proteins desirable solubility and pharmacokinetic properties well known to be associated with glycosylation.
FIG. 2 shows that rAb.antigen fusion proteins employing identical IgG H and L sequences can differ dramatically in efficiency of secretion. In both sited examples, rAb.doc entities are well expressed compared to rAb fused to Influenza HAS sequences which typically express very poorly. The invention also embodies the unanticipated capacity of the dockerin domain to not significantly hinder the secretion of the associated rAb entity. Furthermore, the invention embodies the property of the dockerin domain to not hinder the functionality of the rAb specific antigen combining regions. This property is exemplified inFIG. 5 which shows concordance between IgFc reactivity and LOX-1 reactivity between anti-LOX1—15C4 rAb proteins and anti-LOX1—15C4.doc. -
FIGS. 4A and 4B show the measurement by anti-human IgFc ELISA of levels of secretion of various rAb.fusion proteins. 2.5 ug each of the H and L chain expression plasmids were transfected into 293F cells and two-fold dilutions of supernatant samples were tested after three days of culture. Y axis values are arbitrary HRP activity. -
FIG. 5 shows the measurement by anti-human IgFc ELISA (HRP activity) and LOX-1.alkaline phoshatase binding (AP activity) of secreted anti-LOX1—15C4 rAb.(blue symbols)and anti-LOX1—15C4.doc rAb (red symbols) proteins. Different ratios totalling 5 ug of the H and L chain expression plasmids were transfected into 293F cells and supernatant samples were tested after three days of culture. - The invention embodies the property of the dockerin domain to be efficiently and functionally expressed in the context of fusion proteins other than hIgG4 and its close derivatives. For example, Table 6 shows the sequence of a rAb.doc entity based on a mouse IgG2b H chain fusion protein.
- TABLE 6 shows the nucleic acid and amino acid sequences for rAB-pCMV(mIgG2bH-Dockerin) or C19. DNA (entire coding region) and amino acid sequence (the predicted secreted product) is shown. The dockerin domain is highlighted in yellow and the H chain and dockerin joining sequence is underlined. The highly predicted N-linked glycosylation site within the dockerin domain is highlighted in red.
-
TABLE 6 rAB-pCMV (mIgG2bH-Dockerin) or C19. (SEQ ID NO.: 12) ATGGGATGGTCATGTATCATCCTTTTTCTAGTAGCAACTGCAACTGGAG TACATTCACAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTGGTGAGGCC TGGGACTTCAGTGAAGTTGTCCTGCAAGGCTTCTGGTTACATCTTTACC AGCTACTGGATGCACTGGGTAAAGCAGAGGCCTGGACAAGGCCTTGAGT GGATCGGACTGATTGATCCTTCTGATAGTTATAGTAAGTACAATCAAAA GTTCAAGGGCAAGGCCACATTGACTGTAGACACATCCTCCAGCACAGCC TACATGCAGCTCAGCAGCCTGACATCTGAGGACTCTGCGGTCTATTACT GTGCAAGAGGGGAGCTCAGTGACTTCTGGGGCCAAGGCACCACTCTCAC AGTCTCCTCAGCCAAAACAACACCCCCATCAGTCTATCCACTGGCCCCT GGGTGTGGAGATACAACTGGTTCCTCTGTGACTCTGGGATGCCTGGTCA AGGGCTACTTCCCTGAGTCAGTGACTGTGACTTGGAACTCTGGATCCCT GTCCAGCAGTGTGCACACCTTCCCAGCTCTCCTGCAGTCTGGACTCTAC ACTATGAGCAGCTCAGTGACTGTCCCCTCCAGCACCTGGCCAAGTCAGA CCGTCACCTGCAGCGTTGCTCACCCAGCCAGCAGCACCACGGTGGACAA AAAACTTGAGCCCAGCGGGCCCATTTCAACAATCAACCCCTGTCCTCCA TGCAAGGAGTGTCACAAATGCCCAGCTCCTAACCTCGAGGGTGGACCAT CCGTCTTCATCTTCCCTCCAAATATCAAGGATGTACTCATGATCTCCCT GACACCCAAGGTCACGTGTGTGGTGGTGGATGTGAGCGAGGATGACCCA GACGTCCGGATCAGCTGGTTTGTGAACAACGTGGAAGTACACACAGCTC AGACACAAACCCATAGAGAGGATTACAACAGTACTATCCGGGTGGTCAG TGCCCTCCCCATCCAGCACCAGGACTGGATGAGTGGCAAGGAGTTCAAA TGCAAGGTCAACAACAAAGACCTCCCATCACCCATCGAGAGAACCATCT CAAAAATTAAAGGGCTAGTCAGAGCTCCACAAGTATACATCTTGCCGCC ACCAGCAGAGCAGTTGTCCAGGAAAGATGTCAGTCTCACTTGCCTGGTC GTGGGCTTCAACCCTGGAGACATCAGTGTGGAGTGGACCAGCAATGGGC ATACAGAGGAGAACTACAAGGACACCGCACCAGTCCTGGACTCTGACGG TTCTTACTTCATATACAGCAAGCTCGATATAAAAACAAGCAAGTGGGAG AAAACAGATTCCTTCTCATGCAACGTGAGACACGAGGGTCTGAAAAATT ACTACCTGAAGAAGACCATCTCCCGGTCTCCGGGTAAAGCTAGCAATTC TCCTCAAAATGAAGTACTGTACGGAGATGTGAATGATGACGGAAAAGTA AACTCCACTGACTTGACTTTGTTAAAAAGATATGTTCTTAAAGCCGTCT CAACTCTGCCTTCTTCCAAAGCTGAAAAGAACGCAGATGTAAATCGTGA CGGAAGAGTTAATTCCAGTGATGTCACAATACTTTCAAGATATTTGATA AGGGTAATCGAGAAATTACCAATATAA (SEQ ID NO.: 13) QVQLQQPGAELVRPGTSVKLSCKASGYIFTSYWMHWVKQRPGQGLEWIG LIDPSDSYSKYNQKFKGKATLTVDTSSSTAYMQLSSLTSEDSAVYYCAR GELSDFWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGY FPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVT CSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPNLEGGPSVF IFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVRISWFVNNVEVHTAQTQ THREDYNSTIRVVSALPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKI KGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTE ENYKDTAPVLDSDGSYFIYSKLDIKTSKWEKTDSFSCNVRHEGLKNYYL KKTISRSPGKASNSPQNEVLYGDVNDDGKVNSTDLTLLKRYVLKAVSTL PSSKAEKNADVNRDGRV DVTILSRYLIRVIEKLPI. -
FIG. 6 shows that when co-transfected with a mIgG kappa expression plasmid, rAB-pCMV(mIgG2bH-Dockerin) plasmid directs the efficient secretion of rAB-mIgG2b.Dockerin fusion protein. InFIG. 6 , a Protein G affinity purified rAb proteins secreted from transfected 293 F cells analyzed by reducing SDS.PAGE and Coomassie Brilliant Blue staining.Lanes - The use of the rAb.doc invention detailed above is the assembly of rAb-antigen or toxin or activator or enzyme complexes via the specificity and tenacity of the dockerin-cohesin interaction. Table 5 shows one embodiment of the invention in the form of a cohesin.alkaline phosphatase fusion protein (coh.AP). Also described are additional embodiments such as an alkaline phosphatase fusion protein containing two cohesion domains (coh.coh.AP) and other proteins are examples of the generality of the invention such as the single cohesin domain fused to other sequences such as the mature sequence of human prostate specific antigen (coh.hPSA) and to the
HA 1 domain of influenza A HAS (coh.Flu HA5-1). - TABLE 7 shows the nucleic acid and amino acid sequences for Mam-pCDM8(Cohesin-SLAML-AP-6× His) or C16. DNA (entire coding region) and amino acid sequence (the predicted secreted product) is shown below. The cohesin domain is highlighted in yellow and the cohesin and alkaline phosphatase joining sequence is underlined. The highly predicted (G-score>0.5, NetOGlyc 3.1 Server—Technical University of Denmark) O-linked glycosylation sites within the cohesin domain and the linker distal to the cohesin domain are highlighted in red. Residues highlighted grey are a C-terminal His tag to facilitate purification via metal affinity chromatography.
-
TABLE 7 Mam-pCDM8 (Cohesin-SLAML-AP-6xHis) or C16. (SEQ ID NO.: 14) ATGGATCCCAAAGGATCCCTTTCCTGGAGAATACTTCTGTTT CTCTCCCTGGCTTTTGAGTTGAGCTACGGACTCGACGATCTG GATGCAGTAAGGATTAAAGTGGACACAGTAAATGCAAAACCG GGAGACACAGTAAGAATACCTGTAAGATTCAGCGGTATACCA TCCAAGGGAATAGCAAACTGTGACTTTGTATACAGCTATGAC CCGAATGTACTTGAGATAATAGAGATAGAACCGGGAGACATA ATAGTTGACCCGAATCCTGACAAGAGCTTTGATACTGCAGTA TATCCTGACAGAAAGATAATAGTATTCCTGTTTGCAGAAGAC AGCGGAACAGGAGCGTATGCAATAACTAAAGACGGAGTATTT GCTACGATAGTAGCGAAAGTAAAAGAAGGAGCACCTAACGGA CTCAGTGTAATCAAATTTGTAGAAGTAGGCGGATTTGCGAAC AATGACCTTGTAGAACAGAAGACACAGTTCTTTGACGGTGGA GTAAATGTTGGAGATACAACAGAACCTGCAACACCTACAACA CCTGTAACAACACCGACAACAACAGATGATCTGGATGCACTC GAGATCATCCCAGTTGAGGAGGAGAACCCGGACTTCTGGAAC CGCGAGGCAGCCGAGGCCCTGGGTGCCGCCAAGAAGCTGCAG CCTGCACAGACAGCCGCCAAGAACCTCATCATCTTCCTGGGC GATGGGATGGGGGTGTCTACGGTGACAGCTGCCAGGATCCTA AAAGGGCAGAAGAAGGACAAACTGGGGCCTGAGTTACCCCTG GCCATGGACCGCTTCCCATATGTGGCTCTGTCCAAGACATAC AATGTAGACAAACATGTGCCAGACAGTGGAGCCACAGCCACG GCCTACCTGTGCGGGGTCAAGGGCAACTTCCAGACCATTGGC TTGAGTGCAGCCGCCCGCTTTAACCAGTGCAACACGACACGC GGCAACGAGGTCATCTCCGTGATGAATCGGGCCAAGAAAGCA GGGAAGTCAGTGGGAGTGGTAACCACCACACGAGTGCAGCAC GCCTCGCCAGCCGGCACCTACGCCCACACGGTGAACCGCAAC TGGTACTCGGACGCCGACGTGCCTGCCTCGGCCCGCCAGGAG GGGTGCCAGGACATCGCTACGCAGCTCATCTCCAACATGGAC ATTGACGTGATCCTAGGTGGAGGCCGAAAGTACATGTTTCGC ATGGGAACCCCAGACCCTGAGTACCCAGATGACTACAGCCAA GGTGGGACCAGGCTGGACGGGAAGAATCTGGTGCAGGAATGG CTGGCGAAGCGCCAGGGTGCCCGGTACGTGTGGAACCGCACT GAGCTCATGCAGGCTTCCCTGGACCCGTCTGTGACCCATCTC ATGGGTCTCTTTGAGCCTGGAGACATGAAATACGAGATCCAC CGAGACTCCACACTGGACCCCTCCCTGATGGAGATGACAGAG GCTGCCCTGCGCCTGCTGAGCAGGAACCCCCGCGGCTTCTTC CTCTTCGTGGAGGGTGGTCGCATCGACCATGGTCATCATGAA AGCAGGGCTTACCGGGCACTGACTGAGACGATCATGTTCGAC GACGCCATTGAGAGGGCGGGCCAGCTCACCAGCGAGGAGGAC ACGCTGAGCCTCGTCACTGCCGACCACTCCCACGTCTTCTCC TTCGGAGGCTACCCCCTGCGAGGGAGCTCCATCTTCGGGCTG GCCCCTGGCAAGGCCCGGGACAGGAAGGCCTACACGGTCCTC CTATACGGAAACGGTCCAGGCTATGTGCTCAAGGACGGCGCC CGGCCGGATGTTACCGAGAGCGAGAGCGGGAGCCCCGAGTAT CGGCAGCAGTCAGCAGTGCCCCTGGACGAAGAGACCCACGCA GGCGAGGACGTGGCGGTGTTCGCGCGCGGCCCGCAGGCGCAC CTGGTTCACGGCGTGCAGGAGCAGACCTTCATAGCGCACGTC ATGGCCTTCGCCGCCTGCCTGGAGCCCTACACCGCCTGCGAC CTGGCGCCCCCCGCCGGCACCACCCACCATCACCATCACCAT TGA (SEQ ID NO.: 15) LDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFV YSYDPNVLEIIEIEPGELIVDPN KSFDTAVYPDRKMIVF LFAEDSGTGAYAITEDGVFATIVAKVKSGAPNGLSVIKFVEV GGFANNDLVEQKTQFFDGGVNVGD EPA P P V P DDLDALEIIPVEEENPDFWNREAAEALGAAKK LQPAQTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPEL PLAMDRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQT IGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRV QRASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISN MDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQ EWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYE IHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGH HESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHV FSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKD GARPDVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQ AHLVHGVQEQTFIAHVMAFAACLEPYTACDLAPPAGT T - TABLE 8 shows the nucleic acid and amino acid sequences for Mam-pCDM8(Cohesin-Cohesin-SLAML-AP-6× His) or C17. DNA (entire coding region) and amino acid sequence (the predicted secreted product) is shown below. The cohesin domain is highlighted in yellow and the cohesin and alkaline phosphatase joining sequence is underlined. The highly predicted O-linked glycosylation sites within the linker distal to the cohesin domains are highlighted in red as is a single highy predicted N-linked glycosylation site (NPT). Residues highlighted grey are a C-terminal His tag to facilitate purificaytion via metal affinity chromatography.
-
TABLE 8 Mam-pCDM8 (Cohesin-Cohesin-SLAML-AP-6xHis) or C17. (SEQ ID NO.: 16) ATGGATCCCAAAGGATCCCTTTCCTGGAGAATACTTCTGTTT CTCTCCCTGGCTTTTGAGTTGAGCTACGGACTCGACGATCTG GATGCAGTAAGGATTAAAGTGGACACAGTAAATGCAAAACCG GGAGACACAGTAAGAATACCTGTAAGATTCAGCGGTATACCA TCCAAGGGAATAGCAAACTGTGACTTTGTATACAGCTATGAC CCGAATGTACTTGAGATAATAGAGATAAAACCGGGAGAATTG ATAGTTGACCCGAATCCTGACAAGAGCTTTGATACTGCAGTA TATCCTGACAGAAAGATAATAGTATTCCTGTTTGCAGAAGAC AGCGGAACAGGAGCGTATGCAATAACTAAAGACGGAGTATTT GCTACGATAGTAGCGAAAGTAAAATCCGGAGCACCTAACGGA CTCAGTGTAATCAAATTTGTAGAAGTAGGCGGATTTGCGAAT AATGACCTTGTAGAACAGAAGACACAGTTCTTTGACGGTGGA GTAAATGTTGGAGATACAACAGAACCTGCAACACCTACAACA CCTGTAACAACACCGACAACAACAGATGATCTGGATGCAGTA AGGATTAAAGTGGACACAGTAAATGCAAAACCGGGAGACACA GTAAATATACCTGTAAGATTCAGTGGTATACCATCCAAGGGA ATAGCAAACTGTGACTTTGTATACAGCTATGACCCGAATGTA CTTGAGATAATAGAGATAAAACCGGGAGAATTGATAGTTGAC CCGAATCCTACCAAGAGCTTTGATACTGCAGTATATCCTGAC AGAAAGATGATAGTATTCCTGTTTGCGGAAGACAGCGGAACA GGAGCGTATGCAATAACTAAAGACGGAGTATTTGCTACGATA GTAGCGAAAGTAAAAGAAGGAGCACCTAACGGACTCAGTGTA ATCAAATTTGTAGAAGTAGGCGGATTTGCGAACAATGACCTT GTAGAACAGAAGACACAGTTCTTTGACGGTGGAGTAAATGTT GGAGATACAACAGAACCTGCAACACCTACAACACCTGTAACA ACACCGACAACAACAGATGATCTGGATGCACTCGAGATCATC CCAGTTGAGGAGGAGAACCCGGACTTCTGGAACCGCGAGGCA GCCGAGGCCCTGGGTGCCGCCAAGAAGCTGCAGCCTGCACAG ACAGCCGCCAAGAACCTCATCATCTTCCTGGGCGATGGGATG GGGGTGTCTACGGTGACAGCTGCCAGGATCCTAAAAGGGCAG AAGAAGGACAAACTGGGGCCTGAGTTACCCCTGGCCATGGAC CGCTTCCCATATGTGGCTCTGTCCAAGACATACAATGTAGAC AAACATGTGCCAGACAGTGGAGCCACAGCCACGGCCTACCTG TGCGGGGTCAAGGGCAACTTCCAGACCATTGGCTTGAGTGCA GCCGCCCGCTTTAACCAGTGCAACACGACACGCGGCAACGAG GTCATCTCCGTGATGAATCGGGCCAAGAAAGCAGGGAAGTCA GTGGGAGTGGTAACCACCACACGAGTGCAGCACGCCTCGCCA GCCGGCACCTACGCCCACACGGTGAACCGCAACTGGTACTCG GACGCCGACGTGCCTGCCTCGGCCCGCCAGGAGGGGTGCCAG GACATCGCTACGCAGCTCATCTCCAACATGGACATTGACGTG ATCCTAGGTGGAGGCCGAAAGTACATGTTTCGCATGGGAACC CCAGACCCTGAGTACCCAGATGACTACAGCCAAGGTGGGACC AGGCTGGACGGGAAGAATCTGGTGCAGGAATGGCTGGCGAAG CGCCAGGGTGCCCGGTACGTGTGGAACCGCACTGAGCTCATG CAGGCTTCCCTGGACCCGTCTGTGACCCATCTCATGGGTCTC TTTGAGCCTGGAGACATGAAATACGAGATCCACCGAGACTCC ACACTGGACCCCTCCCTGATGGAGATGACAGAGGCTGCCCTG CGCCTGCTGAGCAGGAACCCCCGCGGCTTCTTCCTCTTCGTG GAGGGTGGTCGCATCGACCATGGTCATCATGAAAGCAGGGCT TACCGGGCACTGACTGAGACGATCATGTTCGACGACGCCATT GAGAGGGCGGGCCAGCTCACCAGCGAGGAGGACACGCTGAGC CTCGTCACTGCCGACCACTCCCACGTCTTCTCCTTCGGAGGC TACCCCCTGCGAGGGAGCTCCATCTTCGGGCTGGCCCCTGGC AAGGCCCGGGACAGGAAGGCCTACACGGTCCTCCTATACGGA AACGGTCCAGGCTATGTGCTCAAGGACGGCGCCCGGCCGGAT GTTACCGAGAGCGAGAGCGGGAGCCCCGAGTATCGGCAGCAG TCAGCAGTGCCCCTGGACGAAGAGACCCACGCAGGCGAGGAC GTGGCGGTGTTCGCGCGCGGCCCGCAGGCGCACCTGGTTCAC GGCGTGCAGGAGCAGACCTTCATAGCGCACGTCATGGCCTTC GCCGCCTGCCTGGAGCCCTACACCGCCTGCGACCTGGCGCCC CCCGCCGGCACCACCCACCATCACCATCACCATTGA (SEQ ID NO.: 17) LDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVY SYDPNVLEIIEIKPGELIVDPNPDKSFDTAVYPDRKIIVFLF AEDSGTGAYAITKDGVFATIVAKVKSGAPNGLSVIKFVEVGG FANNDLVEQKTQFFDGGVNVGD EPA P PV P DDLDAVRIKVDTVNAKPGDTVNIPVRFSGIPSK GIANCDFVYSYDPNVLEIIEIKPGELIVDP KSFDTAVYP DRKMIVFLFAEDSGTGAYAITKDGVFATIVAKVKEGAPNGLS VIKFVEVGGFANNDLVEQKTQFFDGGVNVGD EPA P PV P DDLDALEIIPVEEENPDFWNREAAEALGAAKKLQPA QTAAKNLIIFLGDGMGVSTVTAARILKGQKKDKLGPELPLAM DRFPYVALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLS AAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHAS PAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDID VILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLA KRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRD STLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESR AYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFG GYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARP DVTESESGSPEYRQQSAVPLDEETHAGEDVAVFARGPQAHLV HGVQEQTFIAHVMAFAACLEPYTACDLAPPAGTT - TABLE 9 shows the nucleic acid and amino acid sequences for Mam-pCDM8(SLAML-Cohesin-hPSA) or C149. DNA (entire coding region) and amino acid sequence (the predicted secreted product) is shown below. The cohesin domain is highlighted in yellow and the cohesin and hPSA joining sequence is underlined. The highly predicted O-linked glycosylation sites within the linker distal to the cohesin domains and a single highly predicted N-linked glycosylation site within the cohesin domain are highlighted in red.
-
TABLE 9 Mam-pCDM8 (SLAML-Cohesin-hPSA) or C149. (SEQ ID NO.: 18) ATGGATCCCAAAGGATCCCTTTCCTGGAGAATACTTCTGTTTCT CTCCCTGGCTTTTGAGTTGAGCTACGGACTCGACGATCTGGATG CAGTAAGGATTAAAGTGGACACAGTAAATGCAAAACCGGGAGAC ACAGTAAGAATACCTGTAAGATTCAGCGGTATACCATCCAGGGA ATAGCAAACTGTGACTTTGTATACAGCTATGACCCGAATGTACT TGAGATAATAGAGATAGAACCGGGAGACATAATAGTTGACCCGA ATCCTGACAAGAGCTTTGATACTGCAGTATATCCTGACAGAAAG ATAATAGTATTCCTGTTTGCAGAAGACAGCGGAACAGGAGCGTA TGCAATAACTAAAGACGGAGTATTTGCTACGATAGTAGCGAAAG TAAAAGAAGGAGCACCTAACGGACTCAGTGTAATCAAATTTGTA GAAGTAGGCGGATTTGCGAACAATGACCTTGTAGAACAGAAGAC ACAGTTCTTTGACGGTGGAGTAAATGTTGGAGATACAACAGAAC CTGCAACACCTACAACACCTGTAACAACACCGACAACAACAGAT GATCTGGATGCACTCGAGGCGCCCCTCATCCTGTCTCGGATTGT GGGAGGCTGGGAGTGCGAGAAGCATTCCCAACCCTGGCAGGTGC TTGTGGCCTCTCGTGGCAGGGCAGTCTGCGGCGGTGTTCTGGTG CACCCCCAGTGGGTCCTCACAGCTGCCCACTGCATCAGGAACAA AAGCGTGATCTTGCTGGGTCGGCACAGCCTGTTTCATCCTGAAG ACACAGGCCAGGTATTTCAGGTCAGCCACAGCTTCCCACACCCG CTCTACGATATGAGCCTCCTGAAGAATCGATTCCTCAGGCCAGG TGATGACTCCAGCCACGACCTCATGCTGCTCCGCCTGTCAGAGC CTGCCGAGCTCACGGATGCTGTGAAGGTCATGGACCTGCCCACC CAGGAGCCAGCACTGGGGACCACCTGCTACGCCTCAGGCTGGGG CAGCATTGAACCAGAGGAGTTCTTGACCCCAAAGAAACTTCAGT GTGTGGACCTCCATGTTATTTCCAATGACGTGTGCGCGCAAGTT CACCCTCAGAAGGTGACCAAGTTCATGCTGTGTGCTGGACGCTG GACAGGGGGCAAAAGCACCTGCTCGGGTGATTCTGGGGGCCCAC TTGTCTGTAATGGTGTGCTTCAAGGTATCACGTCATGGGGCAGT GAACCATGTGCCCTGCCCGAAAGGCCTTCCCTGTACACCAAGGT GGTGCATTACCGGAAGTGGATCAAGGACACCATCGTGGCCAACC CCTGA (SEQ ID NO.: 19) LDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANCDFVYS YDPNVLEIIEIEPGELIVDPNP KSFDTAVYPDRKMIVFLFA EDSGTGAYAITEDGVFATIVAKVKSGAPNGLSVIKFVEVGGFAN NDLVEQKTQFFDGGVNVGD EPA P PV P DDLDALEAPLILSRIVGGWECEKHSQPWQVLVASRGRA VCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQV SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAV KVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQ GITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP - TABLE 10 shows the nucleic acid and amino acid sequences for Mam-pCDM8(SLAML-Cohesin-FluHA5-1-6× His) or C24. DNA (entire coding region) and amino acid sequence (the predicted secreted product) is shown below. The cohesin domain is highlighted in yellow and the cohesin and Flu HA5-1 joining sequence is underlined. The highly predicted O-linked glycosylation sites within the linker distal to the cohesin domains and a single highly predicted N-linked glycosylation site within the cohesin domain are highlighted in red. Residues highlighted grey are a C-terminal His tag to facilitate purification via metal affinity chromatography.
-
TABLE 10 Mam-pCDM8 (SLAML-Cohesin-FluHA5-1-6x-His) or C24. (SEQ ID NO.: 20) ATGGATCCCAAAGGATCCCTTTCCTGGAGAATACTTCTG TTTCTCTCCCTGGCTTTTGAGTTGAGCTACGGACTCGAC GATCTGGATGCAGTAAGGATTAAAGTGGACACAGTAAAT GCAAAACCGGGAGACACAGTAAGAATACCTGTAAGATTC AGCGGTATACCATCCAAGGGAATAGCAAACTGTGACTTT GTATACAGCTATGACCCGAATGTACTTGAGATAATAGAG ATAGAACCGGGAGACATAATAGTTGACCCGAATCCTGAC AAGAGCTTTGATACTGCAGTATATCCTGACAGAAAGATA ATAGTATTCCTGTTTGCAGAAGACAGCGGAACAGGAGCG TATGCAATAACTAAAGACGGAGTATTTGCTACGATAGTA GCGAAAGTAAAAGAAGGAGCACCTAACGGACTCAGTGTA ATCAAATTTGTAGAAGTAGGCGGATTTGCGAACAATGAC CTTGTAGAACAGAAGACACAGTTCTTTGACGGTGGAGTA AATGTTGGAGATACAACAGAACCTGCAACACCTACAACA CCTGTAACAACACCGACAACAACAGATGATCTGGATGCA CTCGAGGATCAGATTTGCATTGGTTACCATGCAAACAAC TCGACAGAGCAGGTTGACACAATAATGGAAAAGAACGTT ACTGTTACACATGCCCAAGACATACTGGAAAAGAAACAC AACGGGAAGCTCTGCGATCTAGATGGAGTGAAGCCTCTA ATTTTGAGAGATTGTAGCGTAGCTGGATGGCTCCTCGGA AACCCAATGTGTGACGAATTCATCAATGTGCCGGAATGG TCTTACATAGTGGAGAAGGCCAATCCAGTCAATGACCTC TGTTACCCAGGGGATTTCAATGACTATGAAAAATTGAAA CACCTATTGAGCAGAATAAACCATTTTGAGAAAATTCAG ATCATCCCCAAAAGTTCTTGGTCCAGTCATGAAGCCTCA TTAGGGGTGAGCTCAGCATGTCCATACCAGGGAAAGTCC TCCTTTTTCAGAAATGTGGTATGGCTTATCAAAAAGAAC AGTACATACCCAACAATAAAGAGGAGCTACAATAATACC AACCAAGAAGATCTTTTGGTACTGTGGGGGATTCACCAT CCTAATGATGCGGCAGAGCAGACAAAGCTCTATCAAAAC CCAACCACCTATATTTCCGTTGGGACATCAACACTAAAC CAGAGATTGGTACCAAGAATAGCTACTAGATCCAAAGTA AACGGGCAAAGTGGAAGGATGGAGTTCTTCTGGACAATT TTAAAGCCGAATGATGCAATCAACTTCGAGAGTAATGGA AATTTCATTGCTCCAGAATATGCATACAAAATTGTCAAG AAAGGGGACTCAACAATTATGAAAAGTGAATTGGAATAT GGTAACTGCAACACCAAGTGTCAAACTCCAATGGGGGCG ATAAACTCTAGCATGCCATTCCACAATATACACCCTCTC ACCATTGGGGAATGCCCCAAATATGTGAAATCAAACAGA TTAGTCCTTGCGCACCATCACCATCACCATTGA (SEQ ID NO.: 21) LDDLDAVRIKVDTVNAKPGDTVRIPVRFSGIPSKGIANC DFVYSYDPNVLEIIEIEPGELIVDPNP KSFDTAVYP DRKMIVFLFAEDSGTGAYAITEDGVFATIVAKVKSGAPN GLSVIKFVEVGGFANNDLVEQKTQFFDGGVNVGD E PA P PV P DDLDALEDQICIGYHANN STEQVDTIMEKNVTVTHAQDILEKKHNGKLCDLDGVKPL ILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKANPVNDL CYPGDFNDYEKLKHLLSRINHFEKIQIIPKSSWSSHEAS LGVSSACPYQGKSSFFRNVVWLIKKNSTYPTIKRSYNNT NQEDLLVLWGIHHPNDAAEQTKLYQNPTTYISVGTSTLN QRLVPRIATRSKVNGQSGRMEFFWTILKPNDAINFESNG NFIAPEYAYKIVKKGDSTIMKSELEYGNCNTKCQTPMGA INSSMPFHNIHPLTIGECPKYVKSNRLVLA . - Similar to the above mentioned rAb.doc constructs, the invention embodies the efficient secretion from mammalian cells of functional cohesin fusion proteins (called herein coh.fusions). It was not obvious that cohesin domains could be so successfully secreted while retaining dockerin-binding function.
FIG. 5 demonstrates that supernatant containing secreted coh.alkaline phosphatase (coh.AP) binds specifically to a rAb.doc protein immobilized on a plastic surface. -
FIGS. 7A and 7B show that the Expression plasmids encoding secreted alkaline phosphatase (AP) or coh.AP directed secretion of functional proteins from transfected 293F cells. After 3 days of culture supernatants were harvested and tested for their ability to bind 0.25 ug of either rAb.doc (top panel) or rAb (lower panel) bound to a 96 well micro-titre plate. After 1 hr of incubation the plates were washed and developed with a chromogenic AP substrate. - The invention embodies the application of assembly of specific protein complexes based on the cohesin.dockerin interaction. Specific antibody.antigen complexes can also be assembled using the established interaction of protein A or protein G IgFc binding domains. The invention embodies unique properties of the cohesin.dockerin interaction that result in greatly superior complex formation compared to the e.g., protein G interaction with IgG. In
FIGS. 6 and 7 the interaction of a cohesin.AP (called Coh.AP) protein is shown to be specific for a rAb.Doc protein. -
FIGS. 8A and 8B shows various dilutions of a supernatant containing secreted G.AP were incubated for 1 hr in micro-titre wells containing 0.25 ug of immobilized mIgG2a, mIgG2b, or a mIgG2b-based rAb.doc. After washing the bound AP activity was developed using chromogenic AP substrate. The proG.AP did not bind to the rAb.doc since it was an isotype variant of mIgG2b that did not interact with the particular protein G domain used in the proG.AP construct. -
FIG. 8B shows an identical study, but employing dilutions of a supernatant containing secreted Coh.AP. Coh.AP binds only to rAb.doc, again demonstrating the specificity of the coh.doc interaction. -
FIG. 9 demonstrates the vastly superior stability of preassembled complexes based on coh.doc interaction compared to proG.IgGFc interaction.FIG. 9 shows the formation of complexes between a fixed amount of proG.AP or coh.AP or coh2.AP (0.1 ug) and immobilized mIgG2b or rAb.doc (0.25 ug) were assembled by incubation for 1 hr in a micro-titre plate. At various times a 20-fold excess of soluble mIgG2b or rAb.doc were added and incubation continued for various times. Plates were then washed and bound AP activity accessed by addition of chromogenic AP substrate. - This example shows the use of such coh.doc complexes in settings containing serum (e.g., tissue culture media and in vivo administration).
FIG. 10 demonstrates the vast superiority of coh.doc complexes compared to proG.IgGFc complexes in such a setting. Under the conditions used, ˜15 ug/ml Ig was sufficient to completely displace bound proG.AP, while the coh.AP remained stably bound to rAb.doc even in the presence of pure serum (15 mg/ml Ig) -
FIG. 10 shows the formation of complexes between a fixed amount of proG.AP or coh.AP (0.1 ug) and immobilized mIgG2b or rAb.doc (0.25 ug) were assembled by incubation for 1 hr in a micro-titre plate. Various dilutions of human serum were added and incubation continued for 4 hrs. Plates were then washed and bound AP activity accessed by addition of chromogenic AP substrate. - The invention also embodies a particular utility of the coh.doc interaction that permits a production process that ensures complete complex formation and that can be concomitant with a purification process for the coh.fusion protein entity. This invention is exemplified in
FIGS. 11 and 12 , which illustrate this process via sequential capture of rAb.doc from culture supernatant by protein G affinity chromatography, followed by capture of coh.antigen from culture supernatant by the proteinG:rAb.doc column. Elution with low pH then releases pure rAb.doc:coh.antigen. If there is an excess of coh.antigen over rAb.doc, them full and complete complex should result. A related embodiment of this invention would be application to the protein G captured rAb.doc of excess pure or partially purified coh.fusion protein. -
FIG. 11 shows a gel of reduced vs. non-reduced SDS.PAGE analysis of rAb.doc:Coh2.AP complexes produced by sequential application of rAb.doc supernatant and coh.AP supernatant to the same protein G affinity column.Lanes -
FIG. 12 is a non-reduced SDS.PAGE analysis of rAb.doc:Coh.Flu HA5-1 complexes produced by sequential application of rAb.doc supernatant and coh.Flu HA5-1 supernatant to the same protein G affinity column.Lanes 1 to 4 left to right show that Coh.Flu HA5-1 co-purifies with rAb.doc. - A well described feature of cohesin domains is their compatibility with the standard E. coli bacterial expression system. The invention embodies the novel use of expression of dockerin fusion proteins in mammalian secretion systems, and it also encompasses the formation of coh.doc complexes where the different components (i.e., coh and doc) are expressed in different systems. This is a great advantage since it affords the possibility of using the most favorable expression system for each component. For example, coh.Flu M1 expression constructs failed to efficiently direct the synthesis of secreted product from transfected mammalian cells. However, coh.Flu M1 was very efficiently expressed as a soluble protein in E. coli. Table 6 shows the sequence of the coh.Flu M1 used in this example.
- TABLE 11 shows the nucleic and amino acid sequence for E coli-pET28(Cohesin-FluM1-6× His) or C32 is shown below. In the amino acid sequence the cohesin domain is highlighted in yellow and the point of fusion between cohesion and influenza A M1 protein is underlined. Residues highliighted grey are a C-terminal His tag to facilitate purificaytion via metal affinity chromatography.
-
TABLE 11 E coli-pET28 (Cohesin-FluM1-6x-His) or C32. (SEQ ID NO.: 22) ATGGATCTGGATGCAGTAAGGATTAAAGTGGACACAGTAAATGCAA AACCGGGAGACACAGTAAATATACCTGTAAGATTCAGTGGTATACC ATCCAAGGGAATAGCAAACTGTGACTTTGTATACAGCTATGACCCG AATGTACTTGAGATAATAGAGATAAAACCGGGAGAATTGATAGTTG ACCCGAATCCTACCAAGAGCTTTGATACTGCAGTATATCCTGACAG AAAGATGATAGTATTCCTGTTTGCGGAAGACAGCGGAACAGGAGCG TATGCAATAACTAAAGACGGAGTATTTGCTACGATAGTAGCGAAAG TAAAAGAAGGAGCACCTAACGGGCTCAGTGTAATCAAATTTGTAGA AGTAGGCGGATTTGCGAACAATGACCTTGTAGAACAGAAGACACAG TTCTTTGACGGTGGAGTAAATGTTGGAGATACAACAGAACCTGCAA CACCTACAACACCTGTAACAACACCGACAACAACAGATGATCTGGA TGCAGCTAGCCTTCTAACCGAGGTCGAAACGTACGTTCTCTCTATC ATCCCGTCAGGCCCCCTCAAAGCCGAGATCGCACAGAGACTTGAAG ATGTCTTTGCAGGGAAGAACACCGATCTTGAGGTTCTCATGGAATG GCTAAAGACAAGACCAATCCTGTCACCTCTGACTAAGGGGATTTTA GGATTTGTGTTCACGCTCACCGTGCCCAGTGAGCGGGGACTGCAGC GTAGACGCTTTGTCCAAAATGCTCTTAATGGGAACGGAGATCCAAA TAACATGGACAAAGCAGTTAAACTGTATAGGAAGCTTAAGAGGGAG ATAACATTCCATGGGGCCAAAGAAATAGCACTCAGTTATTCTGCTG GTGCACTTGCCAGTTGTATGGGCCTCATATACAACAGGATGGGGGC TGTGACCACTGAAGTGGCATTTGGCCTGGTATGCGCAACCTGTGAA CAGATTGCTGACTCCCAGCATCGGTCTCATAGGCAAATGGTGACAA CAACCAATCCACTAATCAGACATGAGAACAGAATGGTTCTAGCCAG CACTACAGCTAAGGCTATGGAGCAAATGGCTGGATCGAGTGAGCAA GCAGCAGAGGCCATGGATATTGCTAGTCAGGCCAGGCAAATGGTGC AGGCGATGAGAACCATTGGGACTCATCCTAGCTCCAGTGCTGGTCT AAAAGATGATCTTCTTGAAAATTTGCAGGCTTACCAGAAACGGATG GGGGTGCAGATGCAGCGATTCAAGCTCGAGCACCACCACCACCACC ACTGA (SEQ ID NO.: 23) MDLDAVRIKVDTVNAKPGDTVNIPVRFSGIPSKGIANCDFVYSYDP NVLEIIEIKPGELIVDPNPTKSFDTAVYPDRKMIVELFAEDSGTGA YAITKDGVFATIVAKVKEGAPNGLSVIKFVEVGGFANNDLVEQKTQ FFDGGVNVGDTTEPATPTTPVTTPTTTDDLDAASLLTEVETYVLSI IPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGIL GFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKRE ITFEIGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATC EQIADSQHRSHRQMVTTTNPLIRHENRINVLASTTAKAMEQMAGSS EQAAEAMDIASQARQMVQAMRTIGTHPSSSAGLKDDLLENLQAYQK RMGVQMQRFKLE - The invention embodies the use of the dockerin.cohesin interaction to assemble ordered and specific complexes for various therapeutic or vaccination purposes. An example is the use of rAb.doc with binding specificity to an internalizing human Dendritic Cell (DC) receptor complexed with coh.Flu M1 protein.
FIG. 11 demonstrates this utility by an in vitro study. DC cultured with anti-DC_rAb.doc:coh.Flu M1, then co-cultured with autologous T cells, directed the expansion of T cells with specific memory of Flu M1. Equivalent doses of coh.Flu M1 alone had no such effect. The study shows at least a 50-fold enhancement of Flu M1-specific T cell expansion via the anti-DC_rAb.doc:coh.Flu M1 compared to coh.Flu M1 alone. -
FIG. 13 shows that functional anti-DC_rAb.doc:coh.Flu M1 complex was formed by mixing the individual purified components. Various amounts of the complex, or coh.Flu M1 alone, were incubated in culture medium with 5E4 human DC (from a HLA201 donor) and 10E5 autologous T cells. After 24 hr, the DC were activated with CD40L and incubation was continued for an additional 9 days. Cells were harvested and stained with a PE-labeled Flu M1 peptide GILGFVFTL (SEQ ID NO.:24) HLA-A2 tetramer and analyzed for the frequency of antigen-specific CD8+ cells. -
FIG. 14 shows a similar example incorporating the additional control of coh.Flu M1 complexed to an isotype-matched mAb.doc with no binding to the human DC.FIG. 12 shows that Anti-DC_rAb directly linked via an H chain fusion to a peptide fragment spanning the Flu M1 GILGFVFTL epitope is also effective in eliciting DC targeted antigen delivery resulting in expansion of Flu M1-specific T cells. However the Anti-DC_rAb.Flu M1 PEP entity was secreted very poorly from mammalian cells, likely precluding production of such a vaccine. This problem illustrates the embodiment of the invention that allows production issues to be solved by employing expression systems appropriate for the (in this case) vaccine antigen. -
FIG. 14 shows that Anti-DC_rAb.doc:coh.Flu M1 or mIgG2b.doc:coh.Flu M1 complexes were formed by mixing the individual purified components. Various amounts of the complexes, or coh.Flu M1 alone, were incubated in culture medium with 5E4 human DC (from a HLA201 donor) and 10E5 autologous T cells. After 24 hr, the DC were activated with CD40L and incubation was continued for an additional 9 days. Cells were harvested and stained with a PE-labeled Flu M1 peptide GILGFVFTL (SEQ ID NO.:24) HLA-A2 tetramer and analyzed for the frequency of antigen-specific CD8+ cells. Concentrations for mIgG2.doc complexes were the same as those for Anti-DC_rAb complexes. -
FIG. 15 shows CD34+ human DC were sorted into CD1a+ and CD14+ subtypes and cultured with and without 3 nM Anti-DC_rAb.Flu M1 PEP or Anti-DC_rAb. Autologous T cells were added after 1 day and culture continued for a further 8 days. Analysis was as described above. The CD1a+ cells were very efficient in expanding Flu MI-specific CD8+ cells only with Anti-DC rAb.Flu M1 PEP treatment. - While one type of embodiment of the invention is a vaccine composed of an Anti-DC-rAb.doc:coh.antigen complex, it is envisioned that in some cases a preferred DC-targeting vaccine will be Anti-DC-rAb.antigen where antigen is likely a string of protective antigens. Identification of such antigens in efficacious combinations compatible with efficient expression in production systems is extremely problematic. One embodiment of the invention affords a method to streamline testing of antigen epitope combinations for the development of such vaccines. Specifically, the invention teaches a method to screen likely antigen epitopes alone and in combinations for efficacy as a prelude to addressing production of the desired Anti-DC-rAb.antigen. For example, TABLE 13 shows the sequences of exemplative cohesin.peptide constructs which can be readily expressed via E. coli systems. Using techniques similar to those described in
FIG. 11 , diverse collections of coh.pep proteins can be readily tested for efficacy as complexes with a single anti-DC_rAb.doc entity. The most efficacious coh.pep compounds can then be engineered directly as anti-DC_rAb.peptide fusion proteins.FIG. 16 shows examples of purified coh.PEP proteins expressed in E. coli. - TABLE 12 shows the amino acid sequence of the melanoma-associated antigen gp100. Well known HLA-A201-restricted dominant peptides are shaded and detailed below the sequence. Peptide sequences labeled M are variants with enhanced affinity for HLA-A201. C180 is an E. coli expression construct that encodes the sequence shown below in which the cohesin domain is shaded blue and the gp100 peptide is shaded grey. Underlined residues bounding the peptide are native to gp100. C-terminal His tags are to facilitate purification via metal affinity chromatography.
- Shown below is the gp100 sequence and the associated peptides referred to above.
- The HLA-A0201 Restricted Peptide Sequences are:
-
GP100 WT: 154-162: KTWGQYWQV (SEQ ID NO.: 26) GP100 M: 209-217 (2M): IMDQVPFSV; (SEQ ID NO.: 27) 209-217 WT: ITDQVPFSV (SEQ ID NO.: 28) GP100 M: 280-288 (9V): YLEPGPVTV (SEQ ID NO.: 29) 280-288 WT: YLEPGPVTA (SEQ ID NO.: 30) - C180 is E. coli-pET28(Cohesin-hgp100-PeptideA-6× His):
- TABLE 13 shows the amino acid sequence of the melanoma antigen MART-1. Well known HLA-A201-restricted dominant peptides are shaded and detailed below the sequence. M peptides show peptide sequence variants with enhanced affinity for HLA-A201. C181 is an E. coli expression construct that encodes the sequence shown below in which the cohesin domain is shaded yellow and the MART-1 peptide is shaded grey. Underlined residues bounding the peptide are native to MART-1. C172 and C174 are two constructs directing the expression of anti-DC_rAb.MART-1 peptide and a matching control rAb.MART-1 peptide H chain. Only the sequences appended to the C-terminal residue are shown. C-terminal His tags are to facilitate purification via metal affinity chromatography.
- MART-1 is:
- The HLA-A0201 Restricted Peptides Sequences are:
- C181 is E. coli-pET28(Cohesin-hMART-1-PeptideB-6× His)
- C186 is E. coli-pET28(Cohesin-Flex-hMART-1-PeptideA-6× His)
- C172 is rAB-pIRES2(mAnti-ASGPR—49C11—7H-LV-hIgG4H-hMART-1-PeptideA)
- C174 is rAB-pIRES2(hIgG4H-hMART-1-PeptideA)
-
FIG. 16 shows E. coli harboring expression plasmids directing the synthesis of coh.pep proteins were grown and induced for specific protein production. Cells were harvested and broken by sonication. The supernatant fractions were applied purified by metal affinity chromatography. Analysis was by reducing SDS.PAGE gel stained by Coomassie Brilliant Blue. The figure shows typical product coh.pep proteins labeled from left to right. - This Example shows the successful use of cohesin and dockerin fusion proteins secreted from mammalian cells. If both fusion partners are rAbs with different specificities (i.e., rAb1.doc and rAb2.coh), then simple mixing results in rAb1.doc:rAb2.coh which is a bi-specific antibody. Bispecific antibodies have many potential therapeutic and technical applications. The invention provides a simple and predictable means to assemble such entities through the doc:coh interaction. Alternately, if rAb1.doc:rAb1.coh were assembled such entities represent controlled cross-linked mAbs with potentially unique biological properties.
- Cohesin.dockerin modules exist in diverse cellulose degrading species. While they have sequence similarities, they can have specificities that do not cross between species. This affords an opportunity to build novel scaffolds composed of cohesins with different specificities and use this scaffold to assemble high order complexes in a spatially and numerically controlled manner. Others have described the core technology for using this notion for biotechnology applications (see Fierobe, H.-P., Mechaly, A., Tardif, C., Belaich, A., Lamed, R., Shoham, Y., Belaich, J.-P., and Bayer, E. A. (2001) Design and production of active cellulosome chimeras: Selective incorporation of dockerin-containing enzymes into defined functional complexes. J. Biol. Chem. 276, 21257-21261.). The invention embodies the specific use of this technology for applications related to manufacture of rAb.(doc:coh.fusion)n complexes where n represents >1 pairings of doc:coh interactions with unique specificities. Thus, the invention envisions the assembly (by simple mixing of components) of spatially ordered complexes between rAb.doc1.doc2.doc3.etc. and coh1 .fusionA, coh2.fusionB, coh3.fusion3, etc. The coh.fusion proteins could represent different antigens, or combinations of antigens and activating agents like cytokines.
- By extension multiple coh:doc specificities could also be used to make bivalent rAbs with higher order antigen specificities. Cellulose degrading bacteria and similar organisms also use cellulose binding domains (CBD) to organize the degradation machinery. The structure of a CBD from Clostridium thermocellum shows that the N and C-termini are in close proximity and are not an integral part of the CBD functional structure. In fact CBD typically occurs linked to other domains such as coh.CBD.coh in cipA. The invention encompasses the use of entities such as coh.CBD.coh to assemble spatially and numerically ordered complexes mimicking antibodies and multi subunit receptors. For example, a IgG kappa chain v region fused to doc1 and a IgG H chain V region linked to doc2 can assemble with coh1.CBD.coh2 to yield VL.doc1:coh1.CBD.coh2:VH.doc2 to yield an entity with affinity and binding specificity analogous to the original mAb. Such entities should be e.g., very useful screening tools for refining mAb specificities through mutagenesis procedures, particularly since the VL and VH component could be mutated independently and combined by mixing in various combinations. As described above, this technology can be readily extended to multiple controlled coh:V.doc combinations potentially yielding binding entities with extremely high specificities and affinities. An extension of this would be using e.g., coh1.coh2.CBD.coh3 as a template for assembly of cytoR1.doc+cytoR2.doc+cytoR3.doc (where cytoR represents the ectodomain of one subunit of a complex cytokine receptor). Such entities will have utility for blocking cytokine interactions for therapy and in biotechnology for measuring cytokines in complex supernatants.
- Currently 1.2 million Americans develop cancer each year and about 500,000 die from the disease, because most cancers cannot be cured once they have metastasized. To develop a new treatment for metastatic cancer, genetic engineering has been used to modify a powerful bacterial toxin, Pseudomonas exotoxin A (PE), so that instead of killing normal cells it selectively kills cancer cells. PE is a three domain protein composed of 613 amino acids. Anti-cancer agents are produced by deleting its binding domain (aa 1-252) and replacing it with the Fv fragment of an antibody or with a growth factor that binds to antigens present on cancer cells. These agents are termed recombinant immunotoxins (RITs). RITs have been made that target Ley present on colon, breast, lung and other epithelial cancers (B3(Fv)-PE38), that target the EGF receptor overexpressed on glioblastomas (TGF-alpha-PE38), that target mutant EGF receptors present on glioblastomas (MR-1(Fv)-PE38KDEL), and that target the IL-2 receptor present on many T and B cell leukemias and lymphomas LMB-2 or anti-Tac(Fv)-PE38 and that target CD22 on B cell malignancies and that target BL22 or RFB4(dsFv)-PE38 ovarian cancers and mesotheliomas (SS IP). These agents are produced in E. coli because large amounts can be readily purified from this source and because the toxin itself would kill mammalian cells expressing it. When administered to mice with the appropriate human cancer xenograft, all these RITs produce complete tumor regressions. Most of these agents are now in clinical trials in humans and several have produced complete and partial remissions in humans with cancer.
- An ideal immunotoxin should be very active so that only small amounts need to be given to cause tumor regressions, stable so it remains functional during the 5-10 hours required to reach the interior of a tumor, and non immunogenic so it can be given repeatedly. Initially, recombinant immunotoxins contained amino acids 253-613 of PE (domains II and III). It has been determined that amino acids 364-395 can be deleted without loss of activity. Increased stability can be addressed by linking the toxin to a whole antibody, which are well known to have long half-lives and the technology in the invention provides this solution.
- While the rAb.Doc:Coh.toxin technology can be applied to known cancer antigens, it can also be tested to kill intra-tumoral DC that are suspected to foster escape of the tumor from immune surveillance. In this latter case, anti-DC toxin therapy could be doubly advantageous since build up of immunity against the administered toxin itself should be suppressed (that is because DC themselves are key to the initiation of this immune response via uptake and processing of the antigen. In this therapy, the DCs that uptake the antigen die and cannot mount the anti-toxin response).
- Frankel (Clinical Cancer Research, 8, 942-944, 2002) describes issues hindering the wider application of immunotoxins. These include production problems which often require refolding of E. coli inclusion body expressed material where misfolding contaminents are problematic. Also, affinity of the immunotoxin for its target is often difficult to obtain in sufficient strength. The technology basis of this invention addresses both these issues—firstly, we found that cohesin.PE38 fusion protein is expressed in E. coli as a soluble protein that can be purified in a fully functional state (with both cohesin and toxin activities in tact) by simple biochemical means without complex refolding. Secondly, high affinity monoclonal antibodies against target antigens can be routinely obtained by one practiced in the art. What is difficult is engineering the antibody variable regions in a form that is fused with toxin and fully functional for target binding. The usual means (e.g., sFv forms) of engineering invarably lead to significant loss of affinity against the target compared to the initial monoclonal antibody. The rAb.Doc:Coh.toxin technology circumvents this issue affording a means to preserve both the high affinity binding sites of the initial mAb (note that humanization of mouse mAb V regions while maintaining high and specific binding activity is routine to one practiced in the art), as well as the beneficial properties of long half-life and non-antigenicity of a full recombinant hIgG context.
- Furthermore since the cohesin.toxin is produced independently, one formulation of the toxin can be conjugated to any number of separately produced targeting rAb.Doc proteins by simple mixing of the component prior to injection of the patient. This greatly simplifies manufacturing as well as research development time. The technology described in the invention can be readily applied to any toxin and any rAb specificity.
- Details of the rAb.Doc:Coh.toxin technology. pRB 391 (from Dr. Pastan) Pastan, Chief of the Laboratory of Molecular Biology, Division of Basic Sciences. NCl, NIH) was used as a template for PCR with primers
-
PE38-N3 (cacggtcaccgtctccaaagcttccggagctagcGAGGGCGGCAGCCTG GCCGCGCT (SEQ ID NO.: 39)) and PE38-C3 (GGCCGGCTCCTGCGAAGGGAGCCGGCCGGTCGCGGCCGCTTACTTCAGG TCCTCGCGCGGCGGTTTGCCG (SEQ ID NO.: 40)). - Cloning was into the previously established construct C21 or E. coli-pET28(Cohesin-6× His) to generate a fusion protein encoding Cohesin-PE38 corresponding to the amino acid sequence shown below (grey residues are cohesin; yellow residues are PE38, separated by a linker sequence native to the cohesin domain).
- Expression and purification of recombinant Coh.PE38 protein—E. coli cells from each 1 L fermentation were resuspended in 25 ml ice-cold 50 mM Tris, 1 mM EDTA pH 8.0 with 0.1 ml of protease inhibitor Cocktail II (Calbiochem). The cells were sonicated on
ice 2×5 min at setting 18 (Fisher Sonic Dismembrator 60) with a 5 min rest period and then spun at 17,000 r.p.m. (Sorvall SA-600) for 20 min at 4° C. The supernatant was passed through 1 ml ANX Sepharose column equilibrated in 50 mM Tris, 1 mM EDTA pH 8.0 and and eluted with a 0-1 M NaCl gradient in Buffer B. Fractions containing Cohesin.PE38 sere identified by SDS.PAGE and pooled fractions were further purified by purification via anti-cohesin mAb affinity chromatography with elution by 0.1 M glycine pH 2.7. - Selective killing of human DC by rAb.Doc targeted Coh.PE38—Human DC were prepared from blood monocytes by culture for 6 days in with GM-CSF and IL-4. The DCs were then cultured with either Coh.PE38 alone, anti-DC-SIGN/L 16E7 rAb.Doc alone, anti-DCIR 24A5.Doc alone, or the rAb.Docs together with Coh.PE38 (1.25 ug/ml of agents were added). After 48 hr the cells were stained with a reagent (7-AAD) that detects apoptotic cells and analyzed by FACS scoring forward versus side scatter and 7-AAD fluorescence.
-
FIG. 17 shows that the DCIR.Doc rAb alone had no effect upon the survival of DCs. However, DC-SIGN/L alone has a survival enhancing effect upon the DC (evidenced both by the scatter analysis and the 7-AAD staining.FIG. 18 shows that Coh.PE38 alone slightly increase the number of 7-AAD scored apoptotic cells (from 22.1-29.8%). However, targeting the Coh.PE38 toxin via DCIR.Doc increased the 7-AAD positive population to 55.3%. The scatter analysis even more dramatically revealed an almost complete loss of the population characteristic of viable DC. Targeting the Coh.PE38 toxin via DC-SIGN/L.Doc increased the 7-AAD positive population to 53.7% with a similar loss of the viable DC scatter population. However, this latter result should be viewed in the context of the survival effect of the DC-SIGN/L.Doc rAb, meaning that the killing can be viewed as from 3.1-53.1% 7-AAD positive. - Using Cohesin-Dockerin Technology to make Multivalent Antibodies. A Cohesin domain was engineered in-frame with the C-terminus of a rAb H chain using PCR based on C17 (Mam-pCDM8(Cohesin-Cohesin-SLAML-AP-6× His))as template. The resulting secreted H chain sequence is shown below (the cohesin domain is highlighted in grey and the C-terminal H chain residue is in bold):
- This expression construct was co-transfected with the appropriate rAb L chain into 293F cells and expression of secreted rAb was appraised by anti-hIgGFc ELISA at
day 3.FIG. 19 shows the expression of anti-DC-SIGN/L and Anti-DC-ASPGR rAb.Coh were efficiently secreted. - Thus both Cohesin and Dockerin domains are readily expressed as rAb fusion proteins. This property is essential for the use of (rAb1.Coh:rAb2.Doc) complexes as bivalent antibodies (i.e., having two different combining specificities in one protein). Bivalent antibodies have many desirable features suited to industrial, analytic, and therapeutic applications. They are, however, difficult to develop and molecular tools used to engineer them typically adulterate desirable features of high affinity and specificity inherent to the parent monoclonal antibodies. The (rAb1.Coh:rAb2.Doc) technology circumvents this obstacle and is, moreover, extensible to higher (than 2) valency of combining power by incorporating multiple Cohesin or Dockerin strings with pair wise specificities as described elsewhere in this application. Furthermore, this technology can be extended to using, e.g., a cytokine to provide the additional valency (i.e., rAb1.Doc:Coh.cytokine).
- For example, a fusion protein between a Cohesin domain and IL-21 was engineered as an expression construct and the Coh.IL-21 protein was efficiently secreted from transiently transfected 293F cells and easily purified by sequential Q Sepharose and anti-Cohesin affinity chromatography. The sequence of the secreted product is shown below with the cohesin domain shown in grey and the IL-21 domain in yellow. This product was fully functional as determined by it's efficacy in sustaining proliferation of human B cells.
- Mam-pCDM8(SLAML-Cohesin-hIL-21)
- Thus rAb.Doc:Coh.IL-21 can deliver concomitant proliferation and activation signals to a B cell (i.e., if the rAb itself has activation properties). This notion can be extended to any rAb with biological properties directed to a particular cell type and any cytokine with activity directed to the same cell type.
FIG. 20 shows the effect of IL-21 and Coh.IL-21 on the proliferation of human B cells. - It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method, kit, reagent, or composition of the invention, and vice versa. Furthermore, compositions of the invention can be used to achieve methods of the invention.
- It will be understood that particular embodiments described herein are shown by way of illustration and not as limitations of the invention. The principal features of this invention can be employed in various embodiments without departing from the scope of the invention. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures described herein. Such equivalents are considered to be within the scope of this invention and are covered by the claims.
- All publications and patent applications mentioned in the specification are indicative of the level of skill of those skilled in the art to which this invention pertains. All publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
- The use of the word “a” or “an” when used in conjunction with the term “comprising” in the claims and/or the specification may mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.” The use of the term “or” in the claims is used to mean “and/or” unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives and “and/or.” Throughout this application, the term “about” is used to indicate that a value includes the inherent variation of error for the device, the method being employed to determine the value, or the variation that exists among the study subjects.
- As used in this specification and claim(s), the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps.
- The term “or combinations thereof” as used herein refers to all permutations and combinations of the listed items preceding the term. For example, “A, B, C, or combinations thereof” is intended to include at least one of: A, B, C, AB, AC, BC, or ABC, and if order is important in a particular context, also BA, CA, CB, CBA, BCA, ACB, BAC, or CAB. Continuing with this example, expressly included are combinations that contain repeats of one or more item or term, such as BB, AAA, MB, BBC, AAABCCCC, CBBAAA, CABABB, and so forth. The skilled artisan will understand that typically there is no limit on the number of items or terms in any combination, unless otherwise apparent from the context.
- All of the compositions and/or methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and/or methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.
Claims (30)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/819,618 US20100330115A1 (en) | 2007-02-02 | 2010-06-21 | Multivariable Antigens Complexed with Targeting Humanized Monoclonal Antibody |
US14/887,151 US20160031988A1 (en) | 2007-02-02 | 2015-10-19 | Multivariable antigens complexed with targeting humanized monoclonal antibody |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US88802907P | 2007-02-02 | 2007-02-02 | |
US12/024,036 US7786267B2 (en) | 2007-02-02 | 2008-01-31 | Multivariable antigens complexed with targeting humanized monoclonal antibody |
US12/819,618 US20100330115A1 (en) | 2007-02-02 | 2010-06-21 | Multivariable Antigens Complexed with Targeting Humanized Monoclonal Antibody |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/024,036 Continuation US7786267B2 (en) | 2007-02-02 | 2008-01-31 | Multivariable antigens complexed with targeting humanized monoclonal antibody |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/887,151 Division US20160031988A1 (en) | 2007-02-02 | 2015-10-19 | Multivariable antigens complexed with targeting humanized monoclonal antibody |
Publications (1)
Publication Number | Publication Date |
---|---|
US20100330115A1 true US20100330115A1 (en) | 2010-12-30 |
Family
ID=39682338
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/024,036 Active US7786267B2 (en) | 2007-02-02 | 2008-01-31 | Multivariable antigens complexed with targeting humanized monoclonal antibody |
US12/819,618 Abandoned US20100330115A1 (en) | 2007-02-02 | 2010-06-21 | Multivariable Antigens Complexed with Targeting Humanized Monoclonal Antibody |
US14/887,151 Abandoned US20160031988A1 (en) | 2007-02-02 | 2015-10-19 | Multivariable antigens complexed with targeting humanized monoclonal antibody |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/024,036 Active US7786267B2 (en) | 2007-02-02 | 2008-01-31 | Multivariable antigens complexed with targeting humanized monoclonal antibody |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/887,151 Abandoned US20160031988A1 (en) | 2007-02-02 | 2015-10-19 | Multivariable antigens complexed with targeting humanized monoclonal antibody |
Country Status (16)
Country | Link |
---|---|
US (3) | US7786267B2 (en) |
EP (2) | EP2114985B1 (en) |
JP (1) | JP5543785B2 (en) |
KR (1) | KR20090114425A (en) |
CN (1) | CN101657464A (en) |
AU (1) | AU2008214077B2 (en) |
BR (1) | BRPI0807344A2 (en) |
CA (1) | CA2715042C (en) |
DK (1) | DK2114985T3 (en) |
ES (1) | ES2536900T3 (en) |
IL (1) | IL200092A0 (en) |
MX (1) | MX2009008143A (en) |
NZ (2) | NZ578657A (en) |
TW (1) | TW200846371A (en) |
WO (1) | WO2008097817A2 (en) |
ZA (1) | ZA200905447B (en) |
Cited By (24)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20110151538A1 (en) * | 2008-08-07 | 2011-06-23 | Ramot At Tel-Aviv University Ltd. | Affinity purification by cohesin-dockerin interaction |
US8454960B2 (en) | 2008-01-03 | 2013-06-04 | The Scripps Research Institute | Multispecific antibody targeting and multivalency through modular recognition domains |
US8557242B2 (en) | 2008-01-03 | 2013-10-15 | The Scripps Research Institute | ERBB2 antibodies comprising modular recognition domains |
US8557243B2 (en) | 2008-01-03 | 2013-10-15 | The Scripps Research Institute | EFGR antibodies comprising modular recognition domains |
US8574577B2 (en) | 2008-01-03 | 2013-11-05 | The Scripps Research Institute | VEGF antibodies comprising modular recognition domains |
US8911734B2 (en) | 2010-12-01 | 2014-12-16 | Alderbio Holdings Llc | Methods of preventing or treating pain using anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with p75 |
WO2014210540A1 (en) | 2013-06-28 | 2014-12-31 | Baylor Research Institute | Dendritic cell asgpr targeting immunotherapeutics for multiple sclerosis |
US9067988B2 (en) | 2010-12-01 | 2015-06-30 | Alderbio Holdings Llc | Methods of preventing or treating pain using anti-NGF antibodies |
US9078878B2 (en) | 2010-12-01 | 2015-07-14 | Alderbio Holdings Llc | Anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with p75 |
US9539324B2 (en) | 2010-12-01 | 2017-01-10 | Alderbio Holdings, Llc | Methods of preventing inflammation and treating pain using anti-NGF compositions |
US9676833B2 (en) | 2010-07-15 | 2017-06-13 | Zyngenia, Inc. | Ang-2-binding modular recognition domain complexes and pharmaceutical compositions thereof |
US9814780B2 (en) | 2010-08-10 | 2017-11-14 | Ecole Polytechnique Federale De Lausanne (Epfl) | Compositions for inducing antigen-specific tolerance |
US9850296B2 (en) | 2010-08-10 | 2017-12-26 | Ecole Polytechnique Federale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US9884909B2 (en) | 2010-12-01 | 2018-02-06 | Alderbio Holdings Llc | Anti-NGF compositions and use thereof |
US10030051B2 (en) | 2008-01-03 | 2018-07-24 | The Scripps Research Institute | Antibody targeting through a modular recognition domain |
US10046056B2 (en) | 2014-02-21 | 2018-08-14 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US10150800B2 (en) | 2013-03-15 | 2018-12-11 | Zyngenia, Inc. | EGFR-binding modular recognition domains |
US10392437B2 (en) | 2010-08-10 | 2019-08-27 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US10526381B2 (en) | 2011-05-24 | 2020-01-07 | Zygenia, Inc. | Multivalent and monovalent multispecific complexes and their uses |
US10821157B2 (en) | 2014-02-21 | 2020-11-03 | Anokion Sa | Glycotargeting therapeutics |
US10946079B2 (en) | 2014-02-21 | 2021-03-16 | Ecole Polytechnique Federale De Lausanne | Glycotargeting therapeutics |
US10953101B2 (en) | 2014-02-21 | 2021-03-23 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11214610B2 (en) | 2010-12-01 | 2022-01-04 | H. Lundbeck A/S | High-purity production of multi-subunit proteins such as antibodies in transformed microbes such as Pichia pastoris |
US11253579B2 (en) | 2017-06-16 | 2022-02-22 | The University Of Chicago | Compositions and methods for inducing immune tolerance |
Families Citing this family (36)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
TWI422594B (en) | 2007-02-02 | 2014-01-11 | Baylor Res Inst | Agents that engage antigen-presenting cells through dendritic cell asialoglycoprotein receptor (dc-asgpr) |
NZ578657A (en) * | 2007-02-02 | 2012-02-24 | Baylor Res Inst | Multivariable antigens complexed with targeting humanized monoclonal antibody |
WO2008097866A2 (en) * | 2007-02-02 | 2008-08-14 | Baylor Research Institute | Vaccines based on targeting antigen to dcir expressed an antigen-presenting cells |
WO2008103947A2 (en) * | 2007-02-23 | 2008-08-28 | Baylor Research Institute | Activation of human antigen-presenting cells through clec-6 |
US20080233140A1 (en) * | 2007-02-23 | 2008-09-25 | Baylor Research Institute | Therapeutic Applications of Activation of Human Antigen-Presenting Cells Through Dectin-1 |
ES2618864T3 (en) | 2009-03-10 | 2017-06-22 | Baylor Research Institute | Vaccines targeting antigen presenting cells |
CN105884903B (en) * | 2009-03-10 | 2019-12-06 | 贝勒研究院 | Antigen presenting cell targeted vaccines |
EP2406286B1 (en) | 2009-03-10 | 2016-05-18 | Baylor Research Institute | Anti-cd40 antibodies and uses thereof |
WO2011071574A2 (en) * | 2009-09-02 | 2011-06-16 | United States Deparment Of The Army, As Represented By The Secretary Of The Army | Monoclonal antibodies against glycoprotein of ebola sudan boniface virus |
EP2477655A4 (en) | 2009-09-14 | 2014-02-12 | Baylor Res Inst | Vaccines directed to langerhans cells |
MX2012012833A (en) * | 2010-05-07 | 2012-11-30 | Baylor Res Inst | Dendritic cell immunoreceptors (dcir)-mediated crosspriming of human cd8+ t cells. |
US20120128710A1 (en) * | 2010-11-02 | 2012-05-24 | Baylor Research Institute | Enhancement of Pathogen-Specific Memory Th17 Cell Responses |
US9623117B2 (en) * | 2011-04-04 | 2017-04-18 | Wisconsin Alumni Research Foundation | Method for selective targeting and entry of bacterial toxins to cells |
CN102850458B (en) * | 2011-06-28 | 2014-10-01 | 华博生物医药技术(上海)有限公司 | Novel recombined dual-function fusion protein and its preparation method and application |
AR088428A1 (en) * | 2011-08-25 | 2014-06-11 | Baylor Res Inst | MULTIPLEXED TEST BASED ON SELF-ASSEMBLED SPHERES FOR ANTIGEN SPECIFIC ANTIBODIES |
AR088220A1 (en) * | 2011-08-29 | 2014-05-21 | Baylor Res Inst | ACTIVATION OF HUMAN DENDRITIC CELLS BY THE DECTIN-1 OR TOLL 2 (TLR2) RECEPTOR IN THE CONTROL OF ALLERGY AND ASTHMA |
PT2782598T (en) * | 2011-11-23 | 2020-09-02 | In3Bio Ltd Codan Services Ltd | Recombinant proteins and their therapeutic uses |
JP6629069B2 (en) * | 2012-06-06 | 2020-01-15 | ゾエティス・エルエルシー | Canine anti-NGF antibody and method thereof |
WO2014031984A1 (en) * | 2012-08-24 | 2014-02-27 | Baylor Research Institute | Immunological detection methods and compositions |
CN103044552B (en) * | 2012-12-11 | 2019-01-29 | 中国医学科学院病原生物学研究所 | The monoclonal antibody of the anti-surface of dendritic cells DEC-205 molecule of humanization |
CN103409451A (en) * | 2013-06-28 | 2013-11-27 | 扬州维克斯生物科技有限公司 | Method for loading tumor antigen peptide to dendritic cell (DC) in targeting manner |
JP7037884B2 (en) | 2014-01-13 | 2022-03-17 | ベイラー リサーチ インスティテュート | New vaccines for HPV and HPV-related diseases |
CN106659774A (en) | 2014-05-16 | 2017-05-10 | 贝勒研究院 | Methods and compositions for treating autoimmune and inflammatory conditions |
EP3253799B1 (en) * | 2015-02-05 | 2020-12-02 | Molecular Templates, Inc. | Multivalent cd20-binding molecules comprising shiga toxin a subunit effector regions and enriched compositions thereof |
KR102580647B1 (en) | 2016-12-07 | 2023-09-20 | 몰레큘러 템플레이츠, 인코퍼레이션. | Shiga toxin A subunit effector polypeptides, Shiga toxin effector scaffolds, and cell-targeting molecules for site-specific conjugation |
EP3424538A1 (en) * | 2017-07-06 | 2019-01-09 | Centre National De La Recherche Scientifique | Bioconjugates with a controlled degree of conjugation, their process of preparation, and the reagents for their preparation |
US10610585B2 (en) | 2017-09-26 | 2020-04-07 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Methods and compositions for treating and preventing HIV |
EP3873532A1 (en) | 2018-10-31 | 2021-09-08 | Novartis AG | Dc-sign antibody drug conjugates |
KR20220004985A (en) | 2019-03-27 | 2022-01-12 | 인쎄름 (엥스띠뛰 나씨오날 드 라 쌍떼 에 드 라 흐쉐르슈 메디깔) | Recombinant protein with CD40 activation properties |
CN110790836A (en) * | 2019-11-22 | 2020-02-14 | 郑州安图生物工程股份有限公司 | Monoclonal antibody of human inhibin B, application and kit thereof |
JP2023525140A (en) | 2020-05-13 | 2023-06-14 | アンセルム(アンスティチュート・ナシオナル・ドゥ・ラ・サンテ・エ・ドゥ・ラ・ルシェルシュ・メディカル) | Recombinant proteins with OX40 activation properties |
CA3184802A1 (en) | 2020-05-26 | 2021-12-02 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Severe acute respiratory syndrome coronavirus 2 (sars-cov-2) polypeptides and uses thereof for vaccine purposes |
WO2022101302A1 (en) | 2020-11-12 | 2022-05-19 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Antibodies conjugated or fused to the receptor-binding domain of the sars-cov-2 spike protein and uses thereof for vaccine purposes |
CA3205280A1 (en) | 2020-12-23 | 2022-06-30 | Inserm (Institut National De La Sante Et De La Recherche Medicale) | Chlamydia vaccine based on targeting momp vs4 antigen to antigen presenting cells |
WO2022162177A1 (en) | 2021-01-29 | 2022-08-04 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Chlamydia trachomatis antigenic polypeptides and uses thereof for vaccine purposes |
WO2023088968A1 (en) | 2021-11-17 | 2023-05-25 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Universal sarbecovirus vaccines |
Citations (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3791932A (en) * | 1971-02-10 | 1974-02-12 | Akzona Inc | Process for the demonstration and determination of reaction components having specific binding affinity for each other |
US3949064A (en) * | 1973-10-26 | 1976-04-06 | Baxter Laboratories, Inc. | Method of detecting antigens or antibodies |
US4174384A (en) * | 1975-06-30 | 1979-11-13 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
US4554101A (en) * | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
US6410241B1 (en) * | 1999-03-24 | 2002-06-25 | Board Of Regents, The University Of Texas System | Methods of screening open reading frames to determine whether they encode polypeptides with an ability to generate an immune response |
US6541011B2 (en) * | 1998-02-11 | 2003-04-01 | Maxygen, Inc. | Antigen library immunization |
US20040258688A1 (en) * | 1995-01-31 | 2004-12-23 | Daniel Hawiger | Enhanced antigen delivery and modulation of the immune response therefrom |
US20040265901A1 (en) * | 2001-08-22 | 2004-12-30 | Shengfeng Li | Compositions and methods for generating antigen-binding units |
US20050064509A1 (en) * | 2003-09-23 | 2005-03-24 | The Regents Of The University Of California | Use of templated self assembly to create novel multifunctional species |
US20050106700A1 (en) * | 2001-10-11 | 2005-05-19 | Tsuyoshi Nomura | Method of purifying recombinant fused protein and method of producing protein using the same |
US7786267B2 (en) * | 2007-02-02 | 2010-08-31 | Baylor Research Institute | Multivariable antigens complexed with targeting humanized monoclonal antibody |
US8057798B2 (en) * | 2007-02-02 | 2011-11-15 | Baylor Research Institute | Vaccines based on targeting antigen to DCIR expressed on antigen-presenting cells |
US8236934B2 (en) * | 2007-02-02 | 2012-08-07 | Baylore Research Institute | Agents that engage antigen-presenting cells through dendritic cell asialoglycoprotein receptor (DC-ASGPR) |
Family Cites Families (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0859835A2 (en) | 1995-10-17 | 1998-08-26 | Genencor International, Inc. | Enzymatic array and process of making same |
FR2748479A1 (en) * | 1996-05-10 | 1997-11-14 | Pasteur Institut | Cellulase proteins with cohesin or dockerin type II domains |
JP2000157282A (en) * | 1998-11-30 | 2000-06-13 | Toyota Central Res & Dev Lab Inc | Enzyme array complex and immobilized enzyme array complex and production of these, carrier molecule, and enzyme |
EP1046651A1 (en) * | 1999-04-19 | 2000-10-25 | Koninklijke Universiteit Nijmegen | Composition and method for modulating dendritic cell-T interaction |
US7560534B2 (en) * | 2000-05-08 | 2009-07-14 | Celldex Research Corporation | Molecular conjugates comprising human monoclonal antibodies to dendritic cells |
US20020048583A1 (en) * | 2000-05-11 | 2002-04-25 | Birgit Schultes | Therapeutic method and composition utilizing antigen-antibody complexation and presentation by dendritic cells |
JP2004236504A (en) * | 2003-02-03 | 2004-08-26 | Toyota Central Res & Dev Lab Inc | Enzyme array complex and immobilized enzyme array complex, method for producing the same, carrier molecule and enzyme |
WO2005058244A2 (en) * | 2003-12-15 | 2005-06-30 | Alexion Pharmaceuticals, Inc. | Novel anti-dc-sign antibodies |
AU2006232920B2 (en) * | 2005-04-06 | 2011-09-29 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
-
2008
- 2008-01-31 NZ NZ578657A patent/NZ578657A/en not_active IP Right Cessation
- 2008-01-31 EP EP08728767.8A patent/EP2114985B1/en active Active
- 2008-01-31 EP EP13178012.4A patent/EP2684889A3/en not_active Withdrawn
- 2008-01-31 NZ NZ592859A patent/NZ592859A/en not_active IP Right Cessation
- 2008-01-31 AU AU2008214077A patent/AU2008214077B2/en not_active Ceased
- 2008-01-31 KR KR1020097018149A patent/KR20090114425A/en not_active Application Discontinuation
- 2008-01-31 DK DK08728767T patent/DK2114985T3/en active
- 2008-01-31 US US12/024,036 patent/US7786267B2/en active Active
- 2008-01-31 WO PCT/US2008/052714 patent/WO2008097817A2/en active Application Filing
- 2008-01-31 MX MX2009008143A patent/MX2009008143A/en active IP Right Grant
- 2008-01-31 CN CN200880010934A patent/CN101657464A/en active Pending
- 2008-01-31 JP JP2009548460A patent/JP5543785B2/en not_active Expired - Fee Related
- 2008-01-31 BR BRPI0807344-9A2A patent/BRPI0807344A2/en not_active IP Right Cessation
- 2008-01-31 ES ES08728767.8T patent/ES2536900T3/en active Active
- 2008-01-31 CA CA2715042A patent/CA2715042C/en active Active
- 2008-02-01 TW TW097104117A patent/TW200846371A/en unknown
-
2009
- 2009-07-27 IL IL200092A patent/IL200092A0/en unknown
- 2009-08-04 ZA ZA200905447A patent/ZA200905447B/en unknown
-
2010
- 2010-06-21 US US12/819,618 patent/US20100330115A1/en not_active Abandoned
-
2015
- 2015-10-19 US US14/887,151 patent/US20160031988A1/en not_active Abandoned
Patent Citations (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3791932A (en) * | 1971-02-10 | 1974-02-12 | Akzona Inc | Process for the demonstration and determination of reaction components having specific binding affinity for each other |
US3949064A (en) * | 1973-10-26 | 1976-04-06 | Baxter Laboratories, Inc. | Method of detecting antigens or antibodies |
US4174384A (en) * | 1975-06-30 | 1979-11-13 | Syva Company | Fluorescence quenching with immunological pairs in immunoassays |
US4554101A (en) * | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
US20040258688A1 (en) * | 1995-01-31 | 2004-12-23 | Daniel Hawiger | Enhanced antigen delivery and modulation of the immune response therefrom |
US6541011B2 (en) * | 1998-02-11 | 2003-04-01 | Maxygen, Inc. | Antigen library immunization |
US6410241B1 (en) * | 1999-03-24 | 2002-06-25 | Board Of Regents, The University Of Texas System | Methods of screening open reading frames to determine whether they encode polypeptides with an ability to generate an immune response |
US20040265901A1 (en) * | 2001-08-22 | 2004-12-30 | Shengfeng Li | Compositions and methods for generating antigen-binding units |
US20050106700A1 (en) * | 2001-10-11 | 2005-05-19 | Tsuyoshi Nomura | Method of purifying recombinant fused protein and method of producing protein using the same |
US20050064509A1 (en) * | 2003-09-23 | 2005-03-24 | The Regents Of The University Of California | Use of templated self assembly to create novel multifunctional species |
US7786267B2 (en) * | 2007-02-02 | 2010-08-31 | Baylor Research Institute | Multivariable antigens complexed with targeting humanized monoclonal antibody |
US8057798B2 (en) * | 2007-02-02 | 2011-11-15 | Baylor Research Institute | Vaccines based on targeting antigen to DCIR expressed on antigen-presenting cells |
US8236934B2 (en) * | 2007-02-02 | 2012-08-07 | Baylore Research Institute | Agents that engage antigen-presenting cells through dendritic cell asialoglycoprotein receptor (DC-ASGPR) |
Non-Patent Citations (7)
Title |
---|
Connick, E., et al., CTL fail to accumulate at sites of HIV-1 replication in lymphoid tissue, J. Immunol. 178:6975-6983, 2007. * |
Gallo, R. C., The end or the beginning of the drive to an HIV-preventive vaccine: a view from over 20 years, The Lancet,366:1894-1898, 2005. * |
Jubala et al., Vet Pathol 42: 468-476, 2005. * |
Levine, A. J., Why do we not yet have a human immunodeficiency virus vaccine? J. Virol. 82(24):11998-12000, 2008. * |
Tacken et al., Blood 106(4): 1278-1284, August 15, 2005. * |
Walker, B. D., and D. R. Burton, Toward an AIDS vaccine, Science 320:760-764, 2008. * |
Yu et al., Investigative Ophthalmology & Visual Science 49(2): 522-527, February 2008. * |
Cited By (48)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8454960B2 (en) | 2008-01-03 | 2013-06-04 | The Scripps Research Institute | Multispecific antibody targeting and multivalency through modular recognition domains |
US8557242B2 (en) | 2008-01-03 | 2013-10-15 | The Scripps Research Institute | ERBB2 antibodies comprising modular recognition domains |
US8557243B2 (en) | 2008-01-03 | 2013-10-15 | The Scripps Research Institute | EFGR antibodies comprising modular recognition domains |
US8574577B2 (en) | 2008-01-03 | 2013-11-05 | The Scripps Research Institute | VEGF antibodies comprising modular recognition domains |
US10030051B2 (en) | 2008-01-03 | 2018-07-24 | The Scripps Research Institute | Antibody targeting through a modular recognition domain |
US20110151538A1 (en) * | 2008-08-07 | 2011-06-23 | Ramot At Tel-Aviv University Ltd. | Affinity purification by cohesin-dockerin interaction |
US9676833B2 (en) | 2010-07-15 | 2017-06-13 | Zyngenia, Inc. | Ang-2-binding modular recognition domain complexes and pharmaceutical compositions thereof |
US10087222B2 (en) | 2010-07-15 | 2018-10-02 | Zyngenia, Inc. | Polynucleotides encoding angiopoietin-2 (ang-2) binding polypeptides |
US11884721B2 (en) | 2010-08-10 | 2024-01-30 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US10471155B2 (en) | 2010-08-10 | 2019-11-12 | École Polytechnique Fédérale De Lausanne (Epfl) | Antigen-specific tolerance and compositions for induction of same |
US10800838B2 (en) | 2010-08-10 | 2020-10-13 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US10392437B2 (en) | 2010-08-10 | 2019-08-27 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US10919963B2 (en) | 2010-08-10 | 2021-02-16 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US10265415B2 (en) | 2010-08-10 | 2019-04-23 | École Polytechnique Fédérale De Lausanne (Epfl) | Compositions for inducing antigen-specific tolerance |
US10265416B2 (en) | 2010-08-10 | 2019-04-23 | École Polytechnique Fédérale de Lausanna (EPFL) | Compositions for generation of immune tolerance to specific antigens |
US9814780B2 (en) | 2010-08-10 | 2017-11-14 | Ecole Polytechnique Federale De Lausanne (Epfl) | Compositions for inducing antigen-specific tolerance |
US9850296B2 (en) | 2010-08-10 | 2017-12-26 | Ecole Polytechnique Federale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US9878048B2 (en) | 2010-08-10 | 2018-01-30 | Ecole Polytechnique Federale De Lausanne (Epfl) | Compositions for generating immune tolerance by targeting erythrocytes |
US11246943B2 (en) | 2010-08-10 | 2022-02-15 | École Polytechnique Fédérale De Lausanne (Epfl) | Antigen-specific tolerance and compositions for induction of same |
US9901645B2 (en) | 2010-08-10 | 2018-02-27 | Ecole Polytechnique Fedrale de Lausanne (EPFL) | Methods for reducing immune responses |
US9901646B2 (en) | 2010-08-10 | 2018-02-27 | Ecole Polytechnique Federale De Lausanne (Epfl) | Methods for induction of antigen-specific immune tolerance |
US9738713B2 (en) | 2010-12-01 | 2017-08-22 | Alderbio Holdings Llc | Methods of preventing or treating pain using anti-NGF antibodies |
US9078878B2 (en) | 2010-12-01 | 2015-07-14 | Alderbio Holdings Llc | Anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with p75 |
US9884909B2 (en) | 2010-12-01 | 2018-02-06 | Alderbio Holdings Llc | Anti-NGF compositions and use thereof |
US8911734B2 (en) | 2010-12-01 | 2014-12-16 | Alderbio Holdings Llc | Methods of preventing or treating pain using anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with p75 |
US10221236B2 (en) | 2010-12-01 | 2019-03-05 | Alderbio Holdings Llc | Anti-NGF antibodies that selectively inhibit the association of NGF with TRKA without affecting the association of NGF with P75 |
US10227402B2 (en) | 2010-12-01 | 2019-03-12 | Alderbio Holdings Llc | Anti-NGF antibodies and anti-NGF antibody fragments |
US9783602B2 (en) | 2010-12-01 | 2017-10-10 | Alderbio Holdings Llc | Anti-NGF compositions and use thereof |
US9783601B2 (en) | 2010-12-01 | 2017-10-10 | Alderbio Holdings Llc | Methods of preventing inflammation and treating pain using anti-NGF compositions |
US10344083B2 (en) | 2010-12-01 | 2019-07-09 | Alderbio Holdings Llc | Anti-NGF compositions and use thereof |
US9718882B2 (en) | 2010-12-01 | 2017-08-01 | Alderbio Holdings Llc | Anti-NGF antibodies that selectively inhibit the association of NGF with TrkA, without affecting the association of NGF with P75 |
US10457727B2 (en) | 2010-12-01 | 2019-10-29 | Alderbio Holdings Llc | Methods of preventing inflammation and treating pain using anti-NGF compositions |
US9539324B2 (en) | 2010-12-01 | 2017-01-10 | Alderbio Holdings, Llc | Methods of preventing inflammation and treating pain using anti-NGF compositions |
US11214610B2 (en) | 2010-12-01 | 2022-01-04 | H. Lundbeck A/S | High-purity production of multi-subunit proteins such as antibodies in transformed microbes such as Pichia pastoris |
US9067988B2 (en) | 2010-12-01 | 2015-06-30 | Alderbio Holdings Llc | Methods of preventing or treating pain using anti-NGF antibodies |
US10526381B2 (en) | 2011-05-24 | 2020-01-07 | Zygenia, Inc. | Multivalent and monovalent multispecific complexes and their uses |
US10150800B2 (en) | 2013-03-15 | 2018-12-11 | Zyngenia, Inc. | EGFR-binding modular recognition domains |
WO2014210540A1 (en) | 2013-06-28 | 2014-12-31 | Baylor Research Institute | Dendritic cell asgpr targeting immunotherapeutics for multiple sclerosis |
US10946079B2 (en) | 2014-02-21 | 2021-03-16 | Ecole Polytechnique Federale De Lausanne | Glycotargeting therapeutics |
US10953101B2 (en) | 2014-02-21 | 2021-03-23 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US10821157B2 (en) | 2014-02-21 | 2020-11-03 | Anokion Sa | Glycotargeting therapeutics |
US10940209B2 (en) | 2014-02-21 | 2021-03-09 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11654188B2 (en) | 2014-02-21 | 2023-05-23 | Ecole Polytechnique Federale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11666638B2 (en) | 2014-02-21 | 2023-06-06 | Ecole Polytechnique Federale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11793882B2 (en) | 2014-02-21 | 2023-10-24 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11801305B2 (en) | 2014-02-21 | 2023-10-31 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US10046056B2 (en) | 2014-02-21 | 2018-08-14 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11253579B2 (en) | 2017-06-16 | 2022-02-22 | The University Of Chicago | Compositions and methods for inducing immune tolerance |
Also Published As
Publication number | Publication date |
---|---|
MX2009008143A (en) | 2009-10-20 |
EP2684889A3 (en) | 2014-03-05 |
NZ592859A (en) | 2012-05-25 |
KR20090114425A (en) | 2009-11-03 |
CA2715042C (en) | 2021-02-02 |
CN101657464A (en) | 2010-02-24 |
CA2715042A1 (en) | 2008-08-14 |
EP2114985A2 (en) | 2009-11-11 |
ES2536900T3 (en) | 2015-05-29 |
NZ578657A (en) | 2012-02-24 |
AU2008214077A1 (en) | 2008-08-14 |
EP2114985B1 (en) | 2014-12-17 |
US7786267B2 (en) | 2010-08-31 |
EP2114985A4 (en) | 2010-09-22 |
DK2114985T3 (en) | 2015-03-30 |
WO2008097817A2 (en) | 2008-08-14 |
US20080254044A1 (en) | 2008-10-16 |
BRPI0807344A2 (en) | 2014-05-20 |
US20160031988A1 (en) | 2016-02-04 |
IL200092A0 (en) | 2010-04-15 |
AU2008214077B2 (en) | 2012-12-13 |
TW200846371A (en) | 2008-12-01 |
JP5543785B2 (en) | 2014-07-09 |
EP2684889A2 (en) | 2014-01-15 |
JP2010518020A (en) | 2010-05-27 |
ZA200905447B (en) | 2010-05-26 |
WO2008097817A3 (en) | 2008-10-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US7786267B2 (en) | Multivariable antigens complexed with targeting humanized monoclonal antibody | |
US11173202B2 (en) | Agents that engage antigen-presenting cells through dendritic cell asialoglycoprotein receptor (DC-ASGPR) | |
AU2008214032B2 (en) | Vaccines based on targeting antigen to DCIR expressed on antigen-presenting cells | |
AU2013200798A1 (en) | Multivariable antigens complexed with targeting humanized monoclonal antibody | |
AU2012245170B2 (en) | Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc-asgpr) | |
AU2014240262B2 (en) | Agents that engage antigen - presenting cells through dendritic cell asialoglycoprotein receptor (dc-asgpr) |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: BAYLOR RESEARCH INSTITUTE, TEXAS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ZURAWSKI, GERARD;FLAMAR, ANNE-LAURE;KLECHEVSKY, EYNAV;SIGNING DATES FROM 20100830 TO 20100831;REEL/FRAME:024940/0406 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
|
AS | Assignment |
Owner name: NATIONAL INSTITUTES OF HEALTH - DIRECTOR DEITR, MA Free format text: CONFIRMATORY LICENSE;ASSIGNOR:BAYLOR RESEARCH INSTITUTE;REEL/FRAME:045065/0816 Effective date: 20180226 |
|
AS | Assignment |
Owner name: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF Free format text: CONFIRMATORY LICENSE;ASSIGNOR:BAYLOR RESEARCH INSTITUTE;REEL/FRAME:045518/0066 Effective date: 20180226 |