US20070269811A1 - Superoxide dismutase (SOD) gene and a method of identifying and cloning thereof - Google Patents
Superoxide dismutase (SOD) gene and a method of identifying and cloning thereof Download PDFInfo
- Publication number
- US20070269811A1 US20070269811A1 US11/499,505 US49950506A US2007269811A1 US 20070269811 A1 US20070269811 A1 US 20070269811A1 US 49950506 A US49950506 A US 49950506A US 2007269811 A1 US2007269811 A1 US 2007269811A1
- Authority
- US
- United States
- Prior art keywords
- seq
- sod
- cdna
- superoxide dismutase
- primer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108010012715 Superoxide dismutase Proteins 0.000 title claims abstract description 154
- 102000019197 Superoxide Dismutase Human genes 0.000 title claims abstract description 150
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 49
- 238000000034 method Methods 0.000 title claims description 26
- 238000010367 cloning Methods 0.000 title claims description 14
- 101150017120 sod gene Proteins 0.000 claims abstract description 33
- 241000588724 Escherichia coli Species 0.000 claims abstract description 30
- 241000269966 Potentilla atrosanguinea Species 0.000 claims abstract description 7
- 239000002299 complementary DNA Substances 0.000 claims description 67
- 108020004414 DNA Proteins 0.000 claims description 27
- 230000000694 effects Effects 0.000 claims description 26
- 241001092489 Potentilla Species 0.000 claims description 20
- 229920001184 polypeptide Polymers 0.000 claims description 20
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 20
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 20
- 239000002773 nucleotide Substances 0.000 claims description 19
- 125000003729 nucleotide group Chemical group 0.000 claims description 19
- 238000012216 screening Methods 0.000 claims description 19
- 102000004190 Enzymes Human genes 0.000 claims description 18
- 108090000790 Enzymes Proteins 0.000 claims description 18
- 230000014509 gene expression Effects 0.000 claims description 15
- 108020004999 messenger RNA Proteins 0.000 claims description 13
- 230000003321 amplification Effects 0.000 claims description 12
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 12
- 239000013612 plasmid Substances 0.000 claims description 12
- 108091026890 Coding region Proteins 0.000 claims description 11
- 239000013598 vector Substances 0.000 claims description 11
- 238000012163 sequencing technique Methods 0.000 claims description 10
- 150000001413 amino acids Chemical class 0.000 claims description 9
- 108091033319 polynucleotide Proteins 0.000 claims description 6
- 102000040430 polynucleotide Human genes 0.000 claims description 6
- 239000002157 polynucleotide Substances 0.000 claims description 6
- 102100022887 GTP-binding nuclear protein Ran Human genes 0.000 claims description 5
- 101000774835 Heteractis crispa PI-stichotoxin-Hcr2o Proteins 0.000 claims description 5
- 101000620756 Homo sapiens GTP-binding nuclear protein Ran Proteins 0.000 claims description 5
- 101100393821 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GSP2 gene Proteins 0.000 claims description 5
- 108020004705 Codon Proteins 0.000 claims description 4
- 101001008919 Homo sapiens Kallikrein-10 Proteins 0.000 claims description 4
- 102100027613 Kallikrein-10 Human genes 0.000 claims description 4
- 108091034117 Oligonucleotide Proteins 0.000 claims description 4
- 239000013604 expression vector Substances 0.000 claims description 4
- 230000009466 transformation Effects 0.000 claims description 4
- 239000003550 marker Substances 0.000 claims description 3
- 230000002194 synthesizing effect Effects 0.000 claims description 3
- 241001515965 unidentified phage Species 0.000 claims description 3
- 108700007698 Genetic Terminator Regions Proteins 0.000 claims description 2
- 238000007796 conventional method Methods 0.000 claims description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 19
- 102000004169 proteins and genes Human genes 0.000 description 19
- 235000018102 proteins Nutrition 0.000 description 18
- 239000000203 mixture Substances 0.000 description 15
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 15
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 14
- 238000006243 chemical reaction Methods 0.000 description 13
- 241000196324 Embryophyta Species 0.000 description 11
- 239000000872 buffer Substances 0.000 description 11
- 239000000499 gel Substances 0.000 description 11
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 9
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 8
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 8
- 229960001484 edetic acid Drugs 0.000 description 8
- 238000011534 incubation Methods 0.000 description 8
- 239000000047 product Substances 0.000 description 8
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 7
- 239000002671 adjuvant Substances 0.000 description 7
- 238000004806 packaging method and process Methods 0.000 description 7
- 239000011780 sodium chloride Substances 0.000 description 7
- 239000012153 distilled water Substances 0.000 description 6
- 239000007993 MOPS buffer Substances 0.000 description 5
- 238000002835 absorbance Methods 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 238000002955 isolation Methods 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 108010054576 Deoxyribonuclease EcoRI Proteins 0.000 description 4
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 4
- 241000283973 Oryctolagus cuniculus Species 0.000 description 4
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 4
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 4
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 4
- 239000011543 agarose gel Substances 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 238000005119 centrifugation Methods 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 229960000268 spectinomycin Drugs 0.000 description 4
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 4
- 239000007858 starting material Substances 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 229910001868 water Inorganic materials 0.000 description 4
- DVLFYONBTKHTER-UHFFFAOYSA-N 3-(N-morpholino)propanesulfonic acid Chemical compound OS(=O)(=O)CCCN1CCOCC1 DVLFYONBTKHTER-UHFFFAOYSA-N 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 3
- 102100034343 Integrase Human genes 0.000 description 3
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 3
- 239000008049 TAE buffer Substances 0.000 description 3
- HGEVZDLYZYVYHD-UHFFFAOYSA-N acetic acid;2-amino-2-(hydroxymethyl)propane-1,3-diol;2-[2-[bis(carboxymethyl)amino]ethyl-(carboxymethyl)amino]acetic acid Chemical compound CC(O)=O.OCC(N)(CO)CO.OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O HGEVZDLYZYVYHD-UHFFFAOYSA-N 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 229940041514 candida albicans extract Drugs 0.000 description 3
- 239000008367 deionised water Substances 0.000 description 3
- 229910021641 deionized water Inorganic materials 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 239000011521 glass Substances 0.000 description 3
- 239000012139 lysis buffer Substances 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 239000012429 reaction media Substances 0.000 description 3
- 239000011541 reaction mixture Substances 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 239000001632 sodium acetate Substances 0.000 description 3
- 235000017281 sodium acetate Nutrition 0.000 description 3
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 3
- 229910000162 sodium phosphate Inorganic materials 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 239000012138 yeast extract Substances 0.000 description 3
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 2
- 208000002109 Argyria Diseases 0.000 description 2
- AUNGANRZJHBGPY-UHFFFAOYSA-N D-Lyxoflavin Natural products OCC(O)C(O)C(O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-UHFFFAOYSA-N 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 2
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 2
- 239000000020 Nitrocellulose Substances 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 2
- OUUQCZGPVNCOIJ-UHFFFAOYSA-M Superoxide Chemical compound [O-][O] OUUQCZGPVNCOIJ-UHFFFAOYSA-M 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 239000008346 aqueous phase Substances 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 238000010804 cDNA synthesis Methods 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 229960005091 chloramphenicol Drugs 0.000 description 2
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- SUYVUBYJARFZHO-RRKCRQDMSA-N dATP Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-RRKCRQDMSA-N 0.000 description 2
- RGWHQCVHVJXOKC-SHYZEUOFSA-N dCTP Chemical compound O=C1N=C(N)C=CN1[C@@H]1O[C@H](CO[P@](O)(=O)O[P@](O)(=O)OP(O)(O)=O)[C@@H](O)C1 RGWHQCVHVJXOKC-SHYZEUOFSA-N 0.000 description 2
- HAAZLUGHYHWQIW-KVQBGUIXSA-N dGTP Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 HAAZLUGHYHWQIW-KVQBGUIXSA-N 0.000 description 2
- NHVNXKFIZYSCEB-XLPZGREQSA-N dTTP Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)C1 NHVNXKFIZYSCEB-XLPZGREQSA-N 0.000 description 2
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 2
- 229960005542 ethidium bromide Drugs 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- PJJJBBJSCAKJQF-UHFFFAOYSA-N guanidinium chloride Chemical class [Cl-].NC(N)=[NH2+] PJJJBBJSCAKJQF-UHFFFAOYSA-N 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 229910001629 magnesium chloride Inorganic materials 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000003032 molecular docking Methods 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 229920001220 nitrocellulos Polymers 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 239000013600 plasmid vector Substances 0.000 description 2
- 229920005862 polyol Polymers 0.000 description 2
- 150000003077 polyols Chemical class 0.000 description 2
- 239000008057 potassium phosphate buffer Substances 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000005215 recombination Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- 239000002151 riboflavin Substances 0.000 description 2
- 235000019192 riboflavin Nutrition 0.000 description 2
- 229960002477 riboflavin Drugs 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- BIIBYWQGRFWQKM-JVVROLKMSA-N (2S)-N-[4-(cyclopropylamino)-3,4-dioxo-1-[(3S)-2-oxopyrrolidin-3-yl]butan-2-yl]-2-[[(E)-3-(2,4-dichlorophenyl)prop-2-enoyl]amino]-4,4-dimethylpentanamide Chemical compound CC(C)(C)C[C@@H](C(NC(C[C@H](CCN1)C1=O)C(C(NC1CC1)=O)=O)=O)NC(/C=C/C(C=CC(Cl)=C1)=C1Cl)=O BIIBYWQGRFWQKM-JVVROLKMSA-N 0.000 description 1
- QIVUCLWGARAQIO-OLIXTKCUSA-N (3s)-n-[(3s,5s,6r)-6-methyl-2-oxo-1-(2,2,2-trifluoroethyl)-5-(2,3,6-trifluorophenyl)piperidin-3-yl]-2-oxospiro[1h-pyrrolo[2,3-b]pyridine-3,6'-5,7-dihydrocyclopenta[b]pyridine]-3'-carboxamide Chemical compound C1([C@H]2[C@H](N(C(=O)[C@@H](NC(=O)C=3C=C4C[C@]5(CC4=NC=3)C3=CC=CN=C3NC5=O)C2)CC(F)(F)F)C)=C(F)C=CC(F)=C1F QIVUCLWGARAQIO-OLIXTKCUSA-N 0.000 description 1
- DWKNOLCXIFYNFV-HSZRJFAPSA-N 2-[[(2r)-1-[1-[(4-chloro-3-methylphenyl)methyl]piperidin-4-yl]-5-oxopyrrolidine-2-carbonyl]amino]-n,n,6-trimethylpyridine-4-carboxamide Chemical compound CN(C)C(=O)C1=CC(C)=NC(NC(=O)[C@@H]2N(C(=O)CC2)C2CCN(CC=3C=C(C)C(Cl)=CC=3)CC2)=C1 DWKNOLCXIFYNFV-HSZRJFAPSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- UXHQLGLGLZKHTC-CUNXSJBXSA-N 4-[(3s,3ar)-3-cyclopentyl-7-(4-hydroxypiperidine-1-carbonyl)-3,3a,4,5-tetrahydropyrazolo[3,4-f]quinolin-2-yl]-2-chlorobenzonitrile Chemical compound C1CC(O)CCN1C(=O)C1=CC=C(C=2[C@@H]([C@H](C3CCCC3)N(N=2)C=2C=C(Cl)C(C#N)=CC=2)CC2)C2=N1 UXHQLGLGLZKHTC-CUNXSJBXSA-N 0.000 description 1
- HFGHRUCCKVYFKL-UHFFFAOYSA-N 4-ethoxy-2-piperazin-1-yl-7-pyridin-4-yl-5h-pyrimido[5,4-b]indole Chemical compound C1=C2NC=3C(OCC)=NC(N4CCNCC4)=NC=3C2=CC=C1C1=CC=NC=C1 HFGHRUCCKVYFKL-UHFFFAOYSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 108091093088 Amplicon Proteins 0.000 description 1
- 241000272525 Anas platyrhynchos Species 0.000 description 1
- 244000241235 Citrullus lanatus Species 0.000 description 1
- 235000012828 Citrullus lanatus var citroides Nutrition 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 241001264174 Cordyceps militaris Species 0.000 description 1
- 102000004594 DNA Polymerase I Human genes 0.000 description 1
- 108010017826 DNA Polymerase I Proteins 0.000 description 1
- 230000007023 DNA restriction-modification system Effects 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 241000252212 Danio rerio Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 241000242711 Fasciola hepatica Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 101710203526 Integrase Proteins 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 108700015679 Nested Genes Proteins 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 239000005662 Paraffin oil Substances 0.000 description 1
- 206010035148 Plague Diseases 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 239000013614 RNA sample Substances 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 241000607720 Serratia Species 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 241000589500 Thermus aquaticus Species 0.000 description 1
- 240000007591 Tilia tomentosa Species 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- LUXUAZKGQZPOBZ-SAXJAHGMSA-N [(3S,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] (Z)-octadec-9-enoate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC1O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]1O LUXUAZKGQZPOBZ-SAXJAHGMSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000012197 amplification kit Methods 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 238000002869 basic local alignment search tool Methods 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- UDSAIICHUKSCKT-UHFFFAOYSA-N bromophenol blue Chemical compound C1=C(Br)C(O)=C(Br)C=C1C1(C=2C=C(Br)C(O)=C(Br)C=2)C2=CC=CC=C2S(=O)(=O)O1 UDSAIICHUKSCKT-UHFFFAOYSA-N 0.000 description 1
- 244000309464 bull Species 0.000 description 1
- 238000010805 cDNA synthesis kit Methods 0.000 description 1
- 108010079058 casein hydrolysate Proteins 0.000 description 1
- 230000005779 cell damage Effects 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- ARUVKPQLZAKDPS-UHFFFAOYSA-L copper(II) sulfate Chemical compound [Cu+2].[O-][S+2]([O-])([O-])[O-] ARUVKPQLZAKDPS-UHFFFAOYSA-L 0.000 description 1
- 229910000366 copper(II) sulfate Inorganic materials 0.000 description 1
- 239000002537 cosmetic Substances 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- SUYVUBYJARFZHO-UHFFFAOYSA-N dATP Natural products C1=NC=2C(N)=NC=NC=2N1C1CC(O)C(COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 SUYVUBYJARFZHO-UHFFFAOYSA-N 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 238000007323 disproportionation reaction Methods 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 238000004945 emulsification Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960000789 guanidine hydrochloride Drugs 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- WRUGWIBCXHJTDG-UHFFFAOYSA-L magnesium sulfate heptahydrate Chemical compound O.O.O.O.O.O.O.[Mg+2].[O-]S([O-])(=O)=O WRUGWIBCXHJTDG-UHFFFAOYSA-L 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000004570 mortar (masonry) Substances 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- VMGAPWLDMVPYIA-HIDZBRGKSA-N n'-amino-n-iminomethanimidamide Chemical compound N\N=C\N=N VMGAPWLDMVPYIA-HIDZBRGKSA-N 0.000 description 1
- AYOOGWWGECJQPI-NSHDSACASA-N n-[(1s)-1-(5-fluoropyrimidin-2-yl)ethyl]-3-(3-propan-2-yloxy-1h-pyrazol-5-yl)imidazo[4,5-b]pyridin-5-amine Chemical compound N1C(OC(C)C)=CC(N2C3=NC(N[C@@H](C)C=4N=CC(F)=CN=4)=CC=C3N=C2)=N1 AYOOGWWGECJQPI-NSHDSACASA-N 0.000 description 1
- VOVZXURTCKPRDQ-CQSZACIVSA-N n-[4-[chloro(difluoro)methoxy]phenyl]-6-[(3r)-3-hydroxypyrrolidin-1-yl]-5-(1h-pyrazol-5-yl)pyridine-3-carboxamide Chemical compound C1[C@H](O)CCN1C1=NC=C(C(=O)NC=2C=CC(OC(F)(F)Cl)=CC=2)C=C1C1=CC=NN1 VOVZXURTCKPRDQ-CQSZACIVSA-N 0.000 description 1
- JPXMTWWFLBLUCD-UHFFFAOYSA-N nitro blue tetrazolium(2+) Chemical compound COC1=CC(C=2C=C(OC)C(=CC=2)[N+]=2N(N=C(N=2)C=2C=CC=CC=2)C=2C=CC(=CC=2)[N+]([O-])=O)=CC=C1[N+]1=NC(C=2C=CC=CC=2)=NN1C1=CC=C([N+]([O-])=O)C=C1 JPXMTWWFLBLUCD-UHFFFAOYSA-N 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- -1 nucleoside triphosphate Chemical class 0.000 description 1
- XULSCZPZVQIMFM-IPZQJPLYSA-N odevixibat Chemical compound C12=CC(SC)=C(OCC(=O)N[C@@H](C(=O)N[C@@H](CC)C(O)=O)C=3C=CC(O)=CC=3)C=C2S(=O)(=O)NC(CCCC)(CCCC)CN1C1=CC=CC=C1 XULSCZPZVQIMFM-IPZQJPLYSA-N 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 230000004792 oxidative damage Effects 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 150000002978 peroxides Chemical class 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 238000006479 redox reaction Methods 0.000 description 1
- BOLDJAUMGUJJKM-LSDHHAIUSA-N renifolin D Natural products CC(=C)[C@@H]1Cc2c(O)c(O)ccc2[C@H]1CC(=O)c3ccc(O)cc3O BOLDJAUMGUJJKM-LSDHHAIUSA-N 0.000 description 1
- 230000010410 reperfusion Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 229920002477 rna polymer Polymers 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- VVLFAAMTGMGYBS-UHFFFAOYSA-M sodium;4-[[4-(ethylamino)-3-methylphenyl]-(4-ethylimino-3-methylcyclohexa-2,5-dien-1-ylidene)methyl]-3-sulfobenzenesulfonate Chemical compound [Na+].C1=C(C)C(NCC)=CC=C1C(C=1C(=CC(=CC=1)S([O-])(=O)=O)S(O)(=O)=O)=C1C=C(C)C(=NCC)C=C1 VVLFAAMTGMGYBS-UHFFFAOYSA-M 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- PIEPQKCYPFFYMG-UHFFFAOYSA-N tris acetate Chemical compound CC(O)=O.OCC(N)(CO)CO PIEPQKCYPFFYMG-UHFFFAOYSA-N 0.000 description 1
- 210000000689 upper leg Anatomy 0.000 description 1
- KMIOJWCYOHBUJS-HAKPAVFJSA-N vorolanib Chemical compound C1N(C(=O)N(C)C)CC[C@@H]1NC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C KMIOJWCYOHBUJS-HAKPAVFJSA-N 0.000 description 1
- 238000003260 vortexing Methods 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- NWONKYPBYAMBJT-UHFFFAOYSA-L zinc sulfate Chemical compound [Zn+2].[O-]S([O-])(=O)=O NWONKYPBYAMBJT-UHFFFAOYSA-L 0.000 description 1
- 229910000368 zinc sulfate Inorganic materials 0.000 description 1
- 239000011686 zinc sulphate Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0089—Oxidoreductases (1.) acting on superoxide as acceptor (1.15)
Definitions
- the present invention relates to a Superoxide dismutase (SOD).
- SOD Superoxide dismutase
- SOD Superoxide dismutase cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea containing coding gene sequence of SEQ ID No. 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity.
- SOD Superoxide dismutase
- SOD Superoxide dismutase
- SOD is a ubiquitous enzyme present in plants, animals and microbes, which protects them against oxidative damage caused by superoxide radical (hereinafter, referred to O 2 ⁇ ).
- the enzyme dismutates superoxide radical into hydrogen peroxide and oxygen as per the following redox reaction: 2O 2 ⁇ . +2H + ⁇ H 2 O 2 +O 2
- thermostability of Cu/Zn SOD isolated from the cotyledon of water melon has been shown, SOD activity reduced: (a) by 40% after 4 hour of incubation at 50.° C.; (b) by 50% after 15 minute of incubation at70° C.; (c) by 80% after 60 minute of incubation at 80° C.; and (d) by 100% after 15 minute of incubation at 100° C.
- thermostability characters as follows: (a) Stable at 37° C. for 60 minutes; Inactivated by 50% when incubated at 50-60° C. for60 minutes; and Inactivated by 100% when incubated at 80° C. for 5 minutes. stability without adding an external External stabilizer is required to enhance stabilizer [the addition of hydrogen the stability of the product contains this peroxide trapping agent, polyols, and enzyme. sugars etc.
- the main object of the invention is to provide a superoxide dismutase (SOD) Superoxide dismutase (SOD) cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea containing coding gene sequence of SEQ ID No. 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity
- Another object of the present invention is to provide a set of primers useful for the amplification of Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein Forward primer 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ and; Reverse primer 5′-TCATCCTTGAAGGCCAATAATACCA-3′
- Another object of the present invention is to provide a method of identifying and cloning of superoxide dismutase (SOD) gene of SEQ ID NO 3, which on expression gives a superoxide dismutase enzyme (EC 1.15.1.1) with the characteristics disclose in U.S. Pat. No. 6,485,950.
- SOD superoxide dismutase
- Yet another object of the present invention is to provide a gene responsible for autoclavable superoxide dismutase from Potentilla.
- Still another object of the present invention is to provide a gene responsible for autoclavable superoxide dismutase from Potentilla that is also functional at sub-zero temperature.
- Still another object of the present invention is to transform bacterial host E. coli with the above said recombinant plasmid vector for expression of the SOD gene in the bacterial host.
- FIG. 1 represents effect of assay temperature on SOD activity. Potentilla SOD expressing in E. coli was purified and assayed before and after autoclaving at different temperatures.
- FIG. 2 represents comparison of the nucleotide sequence of the Potentilla Cu/Zn SOD with sequences from other plant species. Regions of complete homology are indicated with asterisks.
- FIG. 5 represents the result of alignment of present sod gene with the sod gene of other plant species
- FIG. 8 represents the details of coding sequence of potentialla SOD gene of SEQ ID NO. 3
- FIG. 9 represents the details of positive cDNA clone of SEQ ID No. 4
- FIG. 10 represents primer Sequence SEQ ID No. 5(a) Forward Primer and Primer sequence SEQ ID No. 5(b): Reverse primer.
- FIG. 10 represents Details of primers used for RACE
- the present invention provides a superoxide dismutase (SOD) cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea, wherein the said cDNA comprises 856 nucleotide bases.
- SOD superoxide dismutase
- the said cDNA has entire coding sequence along with pre- and post-coding sequences.
- the present invention also provides a superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein the said coding cDNA comprises 459 nucleotide bases.
- SOD superoxide dismutase
- SOD superoxide dismutase
- the said polypeptide is autoclavable.
- the said polypeptide is functional at temperature range of ⁇ 10° C. to +80° C.
- the present invention further provides a set of primers useful for the amplification of Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein Forward primer 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ and; Reverse primer 5′-TCATCCTTGAAGGCCAATAATACCA-3′
- primers comprising: Forward Primer: 5′-GTTGTAAAACGACGTGCCAGT-3′ Reverse Primer: 5′-CACAGGAAACAGCTATGACC-3′;
- step (e) amplifying the ends of cDNA obtained from step (e) through rapid amplification of cDNA ends technique (RACE) using two set of primers to get the full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers comprising: Forward Primer: 5′-CCAGTGGATTTGCTAAGCTCATGTCCA-3′ Reverse Primer: 5′-GTCATCAGGGTCTGCATGGACAACAAC-3′ Forward Primer: 5′-ATGGTTGCATGTCAACTGGACCACATT-3′ Reverse Primer: 5′-TTGCATGTCAACTGGACCACATTTCAA-3′
- step (e) amplifying the ends of cDNA obtained from step (e) through rapid amplification of cDNA ends technique (RACE) using different set of primers to get the full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO.
- RACE rapid amplification of cDNA ends technique
- the polyclonal antibodies were raised against the purified SOD and used for cDNA library screening synthesized from young leaf mRNA.
- PCR polymerase chain reaction
- sequences of the said cDNA clones does not have the start and end codon and smaller by 21%.
- primers were designed based on the sequences of positive cDNA clones and the rapid amplification of cDNA ends technique (hereinafter called as RACE) was employed to amplify the SOD full length gene.
- RACE rapid amplification of cDNA ends technique
- the said SOD gene is sequenced and analyzed comprising the sequences set forth in SEQ ID No. 2.
- the said full length SOD gene contains 856 nucleotide bases.
- the said full length SOD gene has entire coding sequence along with pre- and post-coding sequences.
- a set of primers are designed based on the full length SOD gene to amplify the superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3.
- the said coding cDNA comprises 459 nucleotide bases.
- said SOD gene is ligated into a vector to yield a recombinant plasmid which upon transformation into a suitable E. coli host resulted into a clone.
- the said coding sequence of SOD gene of SEQ ID No. 3 corresponding to polynucleotides encoding Superoxide dismutase (SOD) enzyme.
- the present invention also provides an expression construct included sequences encoding a selectable marker and a terminator sequence.
- RNA bases having essentially the same bases as a specific RNA sequence (e.g., mRNA).
- the invention also embraced polynucleotides encoding the amino acid sequences set out in SEQ ID No. 1.
- the invention also provided host cells, comprising a polynucleotide of the invention in a manner that permits expression of the encoded SOD polypeptide.
- Suitable host cells for transformation with the SOD gene of the invention include bacterial cells e.g. E. coli.
- Polynucleotides of the invention may be introduced into the host cell as a part of a circular plasmid using the well known methods for introducing DNA into the host cell and routinely practiced in the art. Host cells of the invention are a valuable source for industrial scale production of recombinant SOD.
- Polyclonal antibody in the present invention refers to an antibody produced in the normal immune system in response to an antigen consists of a number of closely related, but not identical proteins).
- Polyclonal antibodies against purified protein were raised in one-year-old male rabbit (New Zealand type).
- Purified SOD protein 100 ⁇ g in 500 ⁇ l of potassium phosphate buffer; pH, 7.0
- Complete Freund's adjuvant was obtained from Bangalore Genei, India that contained paraffin oil, mannide monooleate as an emulsifier and heat killed Mycobacterium tuberculosis.
- a booster dose (1 ml, containing 60 ⁇ g of purified protein emulsified in 1 ml of incomplete adjuvant) was administered.
- Adjuvant 500 ⁇ l was thoroughly emulsified with the purified enzyme (500 ⁇ l: 100 ⁇ g) to obtain a stable antigen-adjuvant emulsion by rapidly withdrawing and expelling the antigen-adjuvant mix using a 22 gauge needle fitted to a sterile syringe. Complete emulsification was tested by placing a drop of the mixture onto a still surface of distilled water. The intactness of the droplet assures complete mixing.
- Antigen-adjuvant mixture 800 ⁇ l was injected in thigh muscles of rabbit using a 22 gauge needle. Blood was collected from heart of the rabbit and allowed to clot for 2 hours at room temperature.
- ODD Ouchterlony Double Diffussion
- agar prepared in 0.15 M NaCl, 20 mM potassium phosphate of pH 7.0 and 0.02% sodium azide was poured to a thickness of 3 mm.
- Antigen (20 ⁇ l containing 4 ⁇ g of protein) and antibody were loaded into the 3 mm diameter well cut with the help of cork-borer.
- Petri plate was covered and kept in a humid environment for 16-24 hour at 37° C. and examined for line of immune precipitation.
- RNA Ribonucleic acid
- Leaf tissue 500 mg was ground in liquid nitrogen to fine powder. Powder was transferred into a new mortar containing 5 ml of the GH buffer (8M guanidine hydrochloride, 20 mM EDTA, 20 mM MES, 100 mM ⁇ ME) and was ground further.
- Resulting homogenate was transferred to an oak-ridge tube containing equal volume of phenol:chloroform:isoamylalcohal (25:24:1). Phases were emulsified by vortexing and separated by centrifugation at 10,000 rpm for 20 min (7° C.). Upper aqueous phase was transferred to a fresh oak-ridge tube and extracted with the equal volume of chloroform:isoamylalcohal (24:1). Resulting upper aqueous phase was transferred to a corex tube and RNA was precipitated by adding 0.2 volume of 1 M acetic acid and 0.7 volume of chilled ethanol. The tubes were kept at ⁇ 72° C. for 3 h.
- RNA was diluted with 15.5 ⁇ l of M1 solution (2 ⁇ l of 5 ⁇ MOPS buffer, 3.5 ⁇ l of formaldehyde, and 10 ⁇ l of formamide [5 ⁇ MOPS buffer: 300 mM sodium acetate, 10 mM MOPS (3- ⁇ N-morpholino]propanesulfonic acid ⁇ , 0.5 mM ethylene diamine tetra-acetic acid (EDTA)] and incubated for 15 minutes at 65° C.
- M1 solution 2 ⁇ l of 5 ⁇ MOPS buffer, 3.5 ⁇ l of formaldehyde, and 10 ⁇ l of formamide
- 5 ⁇ MOPS buffer 300 mM sodium acetate
- 10 mM MOPS (3- ⁇ N-morpholino]propanesulfonic acid ⁇ 0.5 mM ethylene diamine tetra-acetic acid (EDTA)
- Poly-A mRNA was purified from the total RNA using dC 10 T 30 oligonucleotides attached covalently to polystyrene-latex particles (OligotexTM, Qiagen Inc). Oligotex selectively binds mRNA with poly-A tail to allow purification leaving all other RNA species that lack poly-A tail. 1 mg of total RNA was used as the starting material for the isolation of the mRNA and manufacturer's instructions were followed during the procedure.
- Poly-A + mRNA was used to synthesize cDNA using TimeSaverTM cDNA synthesis kit (Amersham Pharmacia Biotech. USA).
- First strand was synthesized using MMLV-reverse transcriptase in the presence of a bifunctional primer [5′d(AAC TGG AAG AAT TC G CGG CCG C AG GAA T 18 )p 3′] having an oligo (dT 18 ) tract at the 3′-end of a restriction site for Not I.
- Second strand synthesis is initiated by DNA polymerase I after RNase H has nicked the RNA strand of the RNA:cDNA hybrid.
- the cDNA produced is extracted with phenol/chloroform and purified on a Sepharose CL-4B spun column.
- An Eco RI adaptor (5′-d[AATTCGGCACGAGG]-3′, [GCCGTGCTCC]p-5′) is ligated to other end of the cDNA.
- cDNA was digested with Not I to release site on oligo (dT 18 -Not I) primer.
- cDNA's with Eco RI and Not I overhangs were phosphorylated to disallow self-ligation but ligation to the dephosphorylated vector.
- NP66 carries the accessory proteins require for excision under the control of a thermo-inducible promoter. In vivo excision is accomplished by infection of NP66 with ⁇ ExCell followed by growth at 39° C., which enables the expression of these accessory proteins.
- the ligated vector and the cDNA fragments were packaged in an in vitro packaging system (Ready to Go Lambda packaging kit, Amersham Pharmacia Biotech. USA).
- In vitro packaging system for lambda DNA uses single lysogen, which codes for all necessary packaging proteins.
- the extract was prepared from E.coli lysogen in which the prophage carries a cos mutation.
- the cos mutation is a deletion in the cos site which prevents the endogenous prophage from being packaged; the exogenous recombinant DNA is, however, efficiently packaged.
- Packaging extracts also lack Eco K and other DNA restriction systems that recognize methylated DNA, which results in the efficient packaging of methylated and unmethylated cDNA.
- the plates were overlaid with IPTG-soaked nitrocellulose filters.
- the filters were overlaid by gently holding filters with blunt ended forceps at opposite edges and centering filter over plate, without trapping any air bubble. Filter was not moved once contact is made with the plate.
- the plates-filters (inverted) were incubated for another 4 h at 37° C. After incubation, the plates were marked with 18-gauge needle by puncturing asymmetrically for future alignment. Filters were removed from plates with protein side up. Positive plaques were selected using the correct orientation of the developed X-ray, filter and the plate. After marking plagues were cored out and placed in 300 ⁇ l of SM buffer for incubation at room temperature.
- the amplified phage was replated for secondary and tertiary screening. After tertiary screening the positive plaques were cored for in vivo phagemid release. For primary screening 10 5 plaque forming unit (pfu) were taken and transferred to membrane. Membranes were hybridized with polyclonal antibody and developed as ECL instruction. Three strong positive clones were obtained and further taken for secondary screening which gave 70% positive signal. A few clones were taken for tertiary screening and this time all the clones gave 100% positive signal after tertiary screening. All the positive plaques were used to release the vector pExCell containing the cloned fragment.
- Host cells were prepared from released strain of E.coli NP66 in 2 ⁇ YT medium (2 ⁇ YT medium: 12 g trypton, 24 g yeast extract and 5 g glycerol in 1 litre of final volume in distilled/deionized water) containing 50 ⁇ g/ml spectinomycin, 30 ⁇ g/ml of chloramphenicol and 0.2% maltose.
- the culture was grown overnight at 32° C. 5ml of 2 ⁇ YT containing 50 ⁇ g/ml spectinomycin, 30 ⁇ g/ml of chloramphenicol and 0.2% maltose was incubated with 50 ⁇ l of the overnight culture. This culture was grown at 32° C. with shaking to an A 600 of 0.5-0.8.
- NZCYM broth 10 g casein hydrolysate, 5 g yeast extract, 5 g NaCl, 1 g casamino acid and 2 g MgSO 4 .7H 2 O in 1 litre of final volume in distilled/deionized water
- 50 ⁇ g/ml spectinomycin 50 ⁇ g/ml spectinomycin to a final A 600 of 2.0.
- Cells were used within 1 h.
- 100 ⁇ l of the prepared NP66 cells were placed in a 15 ml sterile glass tube and incubated at 39° C.
- LB medium 10 g trypton, 5 g yeast extract, 10 g sodium chloride in 1 litre of final volume in distilled/deionized water
- lysis buffer Tris-Cl 10 mM, 1 mM EDTA, pH 8.0
- tween 20 0.1% tween 20
- Plasmid released in the colony lysate was amplified using 0.2 ⁇ M of each ‘forward’(5′-GTTGTAAAACGACGGCCAGT-3′) and ‘reverse’ (5′-CACAGGAAACAGCTATGACC-3′) flanking primer, 20 ⁇ M of dNTPs and 1 Units of Thermus aquaticus (hereinafter referred to Taq) DNA polymerase (purchased from M/S. Qiagen, Germany) in 1 ⁇ PCR buffer (20 mM Tris-Cl (pH, 8.4), 50 mM KCl, 1.5 mM MgCl 2 ).
- Taq Thermus aquaticus
- dNTPs refere to deoxy nucleoside triphosphate which comprises of deoxyadenosine triphosphate (hereinafter referred to dATP), deoxyguanosine triphosphate (hereinafter referred to dGTP), deoxycytidine triphosphate (hereinafter referred to dCTP) and deoxythymidine triphosphate (hereinafter referred to dTTP).
- dATP deoxyadenosine triphosphate
- dGTP deoxyguanosine triphosphate
- dCTP deoxycytidine triphosphate
- dTTP deoxythymidine triphosphate
- Sequencing primers used were ‘forward’ 5′- INFORMATION FOR SEQ ID NO:4 (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 365 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: double (D) TOPOLOGY: circular (ii) MOLECULE TYPE: cDNA (iii) SEQUENCE DESCRIPTION: SEQ ID NO:4 5′CAAGAGGGAGATGGCCCAACTACTGTGACCGGAAACATTTCTGGCCTC AAGCCTGGGCTTCATGGTTCATGCTCTTGGGGACACAACCAA TGGTTGCATGTCAACTGGACCACATTTCAATCCTGCTGGCAAAGAGCATG GGTCTCCTGAAGATGAGACTCGTCATGCTGGTGATCTTGGAAATATCACT GTTGGGGATGACGGAACTGCTTGCTTCACAATTGTTGACAAACAGATTCC TCTCACTGGGGATGACGGAACTGCTTGCTTCACAATTGTTGACAAACAGATTCC
- Rapid amplification of cDNA ends was used to isolate full length SOD gene from Potentilla atrosanguinea.
- RACE amplifies DNA sequences from a messenger RNA template between a defined internal site and unknown sequences of either the 3′ or 5′ end (Frohman, M. A., Dush. M. K. and Martin, G. R. (1988) Proc. Natl. Acad. Sci. USA 85: 8998-9002; U.S. Pat. Nos. 5,962,271 and 5,962,272).
- a set of gene specific primers were used to generate 5′ and 3′ ends of the gene separately.
- the partial cDNA sequence (SEQ ID No; 1) was used to design two sets of primers.
- Primers were designed such that the amplified 5′ and 3′ ends overlap each other over a small stretch of nucleotides.
- 5′ RACE a gene specific primer (hereinafter referred to GSP1),5′-CCAGTGGATTTGCTAAGCTCATGTCCA-3′ for primary PCR and one nested gene specific primer (hereinafter referred to NES1), 5′-GTCATCAGGGTCTGCATGGACAACAAC-3′ for secondary PCR (RACE). It has been used 1 ⁇ l of 10 ⁇ M nested primers stock for secondary PCR.
- GSP2 3′ RACE a gene specific primer
- NES2 one nested primer
- 5′-TTGCATGTCAACTGGACCACATTTCAA-3′ were designed. Primers were designed such that the amplified 5′ and 3′ ends overlap each other over a small stretch of nucleotides.
- the cDNA for 5′-RACE was synthesized using a modified lock-docking oligo(dT) primer and SMART II A oligo (dT) primer.
- the modified oligo (dT) primer termed the 5′-RACE CDS Primer (5′-CDS) has two degenerate nucleotide positions at the 3′ end.
- 3′ RACE ready cDNA 1 ⁇ g of total RNA was reverse transcribed in separate reactions to yield 5′ and 3′ RACE ready cDNA using an enzyme known as reverse transcriptase.
- the reaction was carried out using 1 ⁇ M of 5′-CDS primer in a reaction mixture containing RNA and 1 ⁇ M SMART II oligo (dT) primer.
- the 3′-RACE cDNA is synthesized using a traditional reverse transcription procedure, but with a special oligo (dT) primer.
- This 3′-RACE CDS Primer A (3′-CDS) primer includes the lock-docking nucleotide positions as in the 5′-CDS and also has a portion of the smart sequence at its 5′ end.
- Primer Primer Sequence SMART II A Oligonucleotide 5′-AAGCAGTGGTATCAACGCAGA GTACGCGGG-3′ 3′-RACE CDS Primer A 5′-AAGCAGTGGTATCAACGCAGA (3′-CDS) GTAC(T) 30 N -1 N-3′ 5′-RACE CDS Primer 5′-(T) 25 N -1 N-3′ (5′-CDS) 10X Universel Long: Primer Mix A (UPM) 5′-TAATACGACTCACTATAGGGC AAGCAGTGGTATCAACGCAGAGT- 3′ Short: 5′-CTAATACGACTCACTATAGGG C-3′ Nested Universal Primer A 5′-AAGCAGTGGTATCAACGCAGA (NUP) GT-3′
- RACE cDNA 5′ and 3′ RACE cDNA were amplified using 0.2 ⁇ M GSP1, GSP2 primer and 1 ⁇ universal primer (UPM), 0.2 mM dNTP and 1 ⁇ BD polymerase mix.
- Thermocycler program consisted of 30 cycles of 94° C. for 30 sec, 68° C. for 30 sec and 72° C. for 3 min. The reaction was up-scaled to 50 ⁇ l and after the completion of PCR, 45 ⁇ l of PCR sample was run on 1.2% agarose gel in TAE buffer containing ethidium bromide (final concentration of 0.5 ⁇ g/ml) Rest of the amplified product was stored at ⁇ 20° C. for secondary PCR if needed.
- CDS Coding Sequence
- CDS of SOD was amplified by PCR using the forward primer 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ and reverse primer 5′-TCATCCTTGAAGGCCAATAATACCA-3′ designed from start codon and stop codon.
- the amplified product was cloned into pQE 30 expression vector and transformed into competent E. coli cells.
- the plasmid was isolated using the standard plasmid isolation protocol (Sambrook, J., Fritsch, E. F. and Maniatis, T. 1989.
- lysis buffer 50 mM NaH 2 PO 4 buffer, pH 8.0, containing 300 mM NaCl and 10 mM imidazole. The cell suspension was sonicated, and the lysate was cleared by centrifugation at 12000 g and 4° C. for 20 min.
- Ni-NTA nickel-nitrilotriacitic acid
- wash buffer 50 mM NaH 2 PO 4 buffer, pH 8.0, containing 300 mM NaCl and 20 mM imidazole
- SOD protein was eluted with elution buffer (50 mM NaH 2 PO 4 buffer, pH 8.0, containing 300 mM NaCl and 250 mM imidazole).
- elution buffer 50 mM NaH 2 PO 4 buffer, pH 8.0, containing 300 mM NaCl and 250 mM imidazole.
- the purified SOD was evaluated by 10% SDS-PAGE using silver staining to visualize the protein ( FIG. 4A ).
- Reaction (performed in a 30 ml glass vial) was initiated by illuminating the reaction with light intensity of 1000 ⁇ Einstein/m 2 /second using a fiber optic light source (Nikon). The reaction was terminated after 2 min and the absorbance was read at 560 nm.
- the purified SOD enzyme was assayed at temperatures ranging between ⁇ 10 to 80 ° C. in the buffer composition as described in Example 10 except that 50% glycerol was added in the reaction mixture to avoid freezing at low temperature.
- a glass beaker of 100 ml capacity was filled with either alcohol (for working at temperatures of ⁇ 10, ⁇ 5, 0° C.) or distilled water (for working at rest of the temperatures) was used to maintain the temperature of the reaction medium while assaying SOD.
- Reaction medium along with the enzyme was pre-equilibrated at desired temperature to avoid time lag in attaining the required temperature.
- the enzyme showed highest activity (87.5% inhibition) at 0° C.
- the enzyme was functional even up to ⁇ 10° C. (82% inhibition).
- the enzyme is expected at temperature lower than ⁇ 10° C.
- the purified SOD was localized on 10% polyacrylamide gel by activity staining as described by Beauchamp and Fridovich (Anal. Biochem. 1971; 44: 246-287). After electrophoresis, the gel was rinsed with distilled water followed by 30 min incubation in 50 ml phosphate buffer (50 mM; pH 7.0) containing 2.5 mM NBT in dark at room temperature. Gel was then immersed in 1.17 ⁇ 10 ⁇ 6 M riboflavin for 20 min, followed by exposure to light source (Nikon). Light exposure led to photogeneration of O 2 ⁇ , which converts NBT into insoluble purple colored formazan. The purple color was developed throughout the gel except for the location where SOD was localized as shown in FIG. 4B .
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Enzymes And Modification Thereof (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention provides a superoxide dismutase gene from Potentilla atrosanguinea, a construct containing the gene coding for superoxide dismutase and transformed E.coli producing the SOD protein.
Description
- The present invention relates to a Superoxide dismutase (SOD). Superoxide dismutase (SOD) cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea containing coding gene sequence of SEQ ID No. 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity.
- Further, it also relates to a set of primers useful for the amplification of Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein
Forward primer 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ and; Reverse primer 5′-TCATCCTTGAAGGCCAATAATACCA-3′ - More particularly, it relates to a method of identifying and cloning of Superoxide dismutase (SOD) gene of
SEQ ID NO 3, which on expression gives a Superoxide dismutase enzyme (EC 1.15.1.1) with the characteristics disclose in U.S. Pat. No. 6,485,950. - SOD is a ubiquitous enzyme present in plants, animals and microbes, which protects them against oxidative damage caused by superoxide radical (hereinafter, referred to O2 −). The enzyme dismutates superoxide radical into hydrogen peroxide and oxygen as per the following redox reaction:
2O2 −.+2H+═H2O2+O2 - Thus, SOD has implications in all those reactions, wherein O2 −. is produced in the amount leading to cellular injury. According to the U.S. Pat. No. 6,485,950, we have extracted an autoclavable superoxide dismutase from Potentilla that could be autoclaved and shows activity at sub-zero temperature. Due to prevalence of Potentilla at difficult to access location of high altitude, and industrial implications of SOD as mentioned in our U.S. Pat. No. 6,485,950, it was essential to develop a system for the production of SOD of Potentilla in E.coli so as to obtain the SOD when desired.
- Below is given state of the art knowledge in relation to isolation of SOD genes from various sources and their expression in E.coli, to produce SOD in recoverable quantities.
- Reference may be made to document (1) by Wang, Z., He, Z., Shen, Q., Gu, Y., Li, S. and Yuan, Q. (J. of Chromatography B, 2005. 826: 114-121) wherein Cu/Zn SOD gene from Cordyceps militaris was overexpressed in E. coli.
- Yet another reference may be made to document (2) by Liu, W., Zhu, R. H., Li, G. P., and Wang, D. C. (Protein Expr. Purif. 2002. 25: 379-388) wherein production of high yield of recombinant duck Cu/Zn SOD was achieved in E. coli.
- Reference may be made to yet another document (3) by Pan, S. M., Hwang, G. B., and Liu, H. C. (Bot. Bull. Acad. Sin. 1999. 40: 275-281) wherein over-expression and characterization of cytosolic Cu/Zn SOD from rice in E. coli was achieved.
- Reference may be made to document (4) by Hartman, J. R., Geller, T., Yavin, Z., Bartfeld, D., Kanner, D., Aviv, H., and Gorecki, M. (Proc. Natl. Acad. Sci. USA. 1986. 83: 7142-7146) wherein high-level expression of enzymatically active human Cu/Zn SOD was reported in E. coli.
- Reference may be made to document (5) by Ken, C. F., Lin, C. T., Shaw, J. F., and Wu, J. L. (Marine Biotech. 2003. 5: 167-173) wherein the Cu/Zn SOD from zebrafish was over-expressed in E. coli and the active enzyme was purified.
- Reference may be made to document (6) by Kim, T. S., Jung, Y., Na, B. K., Kim, K. S., and Chung, P. R. (Infect. Immun. 2000. 68: 3941-3948) wherein the Cu/Zn SOD gene from Fasciola hepatica was cloned and expressed in E. coli.
- The drawbacks are:
-
- 1. There is no SOD gene that is isolated from Potentilla, a source of Cu/ZnSOD that is autoclavable and functions at sub-zero temperature.
- 2. There is no SOD gene that is isolated from Potentilla and made to express in E. coli.
- 3. There is no SOD gene that is made to express in E.coli leading to SOD protein that is shown to be autoclavable.
- 4. There is no SOD gene that is made to express in E.coli leading to SOD protein that is shown to function at sub-zero temperature.
Comparative data of present SOD with other known SOD Present invention Prior art The maximum thermostability of The maximum thermostability of SOD is SOD described so far is at 80° C. 37° C. to 50° C. reference from Bueno P., Verla, J., Gallego, G. G., and Rio del A. L. (Plant Physiol. 1995. 108: 1151-1160) wherein the thermostability of Cu/Zn SOD isolated from the cotyledon of water melon has been shown, SOD activity reduced: (a) by 40% after 4 hour of incubation at 50.° C.; (b) by 50% after 15 minute of incubation at70° C.; (c) by 80% after 60 minute of incubation at 80° C.; and (d) by 100% after 15 minute of incubation at 100° C. Reference may be made to Document by Miyata, K., Maejima, K., and Tomoda, K. (U.S. Pat. No. 4,563,349; Jan. 7, 1986) wherein SOD has been reported from a microorganism belonging to genus Serratia having the thermostability characters as follows: (a) Stable at 37° C. for 60 minutes; Inactivated by 50% when incubated at 50-60° C. for60 minutes; and Inactivated by 100% when incubated at 80° C. for 5 minutes. stability without adding an external External stabilizer is required to enhance stabilizer [the addition of hydrogen the stability of the product contains this peroxide trapping agent, polyols, and enzyme. sugars etc. are required to stabilise the Reported SODs do not retain their enzyme from other sources such as activity at ambient temperature unless germinated plant seeds stabilized by the addition of polyols, sugars or any other stabilizing agent (Bresson-Rival; Delphine; Boivin; Patrick; Linden; Guy; Perrier; Erric; Humbert; Gerard; 1999; U. S. Pat. No. Wide range of temperature Temperature range for SOD activity has functionality from sub-zero to above been reported between 5 to 45. degree. C. 50.degree. C. temperature which Hakam, N. and Simon, J. P. 1996. would immensely enhance the utility Physiol. Plant. 97: 209-216). However, of the enzyme and its products and be thermostability and lower temperature safer for use for humans. for catalyzing dismutation of O.sub.2.sup.−. are not reported for the same enzyme. Present enzyme is autoclavable. There is no report for autoclavable SOD. When SOD is to be injected in the body, a sterile composition would be needed and for that an autoclavable SOD would be an ideal one. Moreover, in reperfusion applications and storage of organs at low temperature, an autoclavable SOD would be required which can function efficiently at low temperature as well. Apart from the use of autoclaved SOD in Pharmaceuticals and medical fields, sterile SOD will also be a choice in the cosmetic and food industry. - The main object of the invention is to provide a superoxide dismutase (SOD) Superoxide dismutase (SOD) cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea containing coding gene sequence of SEQ ID No. 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity
- Another object of the present invention is to provide a set of primers useful for the amplification of Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein
Forward primer 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ and; Reverse primer 5′-TCATCCTTGAAGGCCAATAATACCA-3′ - Further, another object of the present invention is to provide a method of identifying and cloning of superoxide dismutase (SOD) gene of
SEQ ID NO 3, which on expression gives a superoxide dismutase enzyme (EC 1.15.1.1) with the characteristics disclose in U.S. Pat. No. 6,485,950. - Yet another object of the present invention is to provide a gene responsible for autoclavable superoxide dismutase from Potentilla.
- Still another object of the present invention is to provide a gene responsible for autoclavable superoxide dismutase from Potentilla that is also functional at sub-zero temperature.
- Still another object of the present invention is to provide a recombinant gene of SOD, which shows activity upon autoclaving and also shows activity at low temperature, in a plasmid vector leading to a new vector which carries the nucleotide sequence synthesizing the said SOD.
- Still another object of the present invention is to transform bacterial host E. coli with the above said recombinant plasmid vector for expression of the SOD gene in the bacterial host.
-
FIG. 1 represents effect of assay temperature on SOD activity. Potentilla SOD expressing in E. coli was purified and assayed before and after autoclaving at different temperatures. -
FIG. 2 represents comparison of the nucleotide sequence of the Potentilla Cu/Zn SOD with sequences from other plant species. Regions of complete homology are indicated with asterisks. -
FIG. 3 represents comparison of the deduced amino acid sequence of the Potentilla Cu/Zn SOD with sequences from other plant species. Regions of complete homology are indicated with asterisks. -
FIG. 4 (A) represents expression and purification of Potentilla SOD in E. coli. C, Control; I, Protein induced by IPTG; P, Purified SOD. The gel was stained by silver staining. (B). Activity staining of the gel to depict the activity of purified SOD. P, Purified SOD. -
FIG. 5 represents the result of alignment of present sod gene with the sod gene of other plant species -
FIG. 6 represents the details of Polypeptide sequence of SOD gene SEQ ID NO. 1. -
FIG. 7 represents the details of full length cDNA SOD gene of SEQ ID No. 2 -
FIG. 8 represents the details of coding sequence of potentialla SOD gene of SEQ ID NO. 3 -
FIG. 9 represents the details of positive cDNA clone of SEQ ID No. 4 -
FIG. 10 represents primer Sequence SEQ ID No. 5(a) Forward Primer and Primer sequence SEQ ID No. 5(b): Reverse primer. -
FIG. 10 represents Details of primers used for RACE - (a) Primer Sequence of SEQ ID No. 6(a) GSP1:Forward primer.
- (b) Primer sequence of SEQ ID No. 6(b) NES1: Reverse Primer
- (c) Primer Sequence of SEQ ID No. 6(c) GSP2: Forward Primer
- (d) Primer sequence of SEQ ID No. 6(d) NES2: Reverse Primer
- The present invention provides superoxide dismutase gene from Potentilla atrosanguinea and its expression in heterologous system and comprises of a construct which carries the coding nucleotide sequence of
SEQ ID 3 which is responsible fore synthesis of said SOD and transformed E.coli producing the SOD protein. This SOD protein is autoclavable and also functions at sub-zero temperature. - Accordingly, the present invention provides a superoxide dismutase (SOD) cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea, wherein the said cDNA comprises 856 nucleotide bases.
- In an embodiment of the present invention, the said cDNA has entire coding sequence along with pre- and post-coding sequences.
- The present invention also provides a superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein the said coding cDNA comprises 459 nucleotide bases.
- Further, it also provides a superoxide dismutase (SOD) polypeptide of SEQ ID No. 1, wherein the said polypeptide comprises 152 amino acids.
- In an embodiment of the present invention, the said polypeptide is autoclavable.
- In another embodiment of the present invention, the said polypeptide is functional at temperature range of <−10° C. to +80° C.
- The present invention further provides a set of primers useful for the amplification of Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein
Forward primer 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ and; Reverse primer 5′-TCATCCTTGAAGGCCAATAATACCA-3′ -
- 1. Further, it provides A method of identifying and cloning of superoxide dismutase (SOD) gene of
SEQ ID NO 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity, wherein the said method comprising the steps of: - a) isolating the mRNA from leaves of potentialla;
- b) synthesizing the cDNA from mRNA as obtained from step (a);
- c) constructing a cDNA library of the DNA of potentilla followed by the cloning of the cDNA obtained from step (b) in a suitable vector preferably in bacteriophage;
- d) screening the said library obtained from step (c) followed by the primary, secondary and tertiary screening for identification of positive cDNA clones;
- e) isolating the DNA from positive cDNA clones obtained from step (d);
- 1. Further, it provides A method of identifying and cloning of superoxide dismutase (SOD) gene of
- f) amplifying the said DNA using the primers comprising:
Forward Primer: 5′-GTTGTAAAACGACGTGCCAGT-3′ Reverse Primer: 5′-CACAGGAAACAGCTATGACC-3′; - g) amplifying the ends of cDNA obtained from step (e) through rapid amplification of cDNA ends technique (RACE) using two set of primers to get the full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers comprising:
Forward Primer: 5′-CCAGTGGATTTGCTAAGCTCATGTCCA-3′ Reverse Primer: 5′-GTCATCAGGGTCTGCATGGACAACAAC-3′ Forward Primer: 5′-ATGGTTGCATGTCAACTGGACCACATT-3′ Reverse Primer: 5′-TTGCATGTCAACTGGACCACATTTCAA-3′ - g) amplifying the ends of cDNA obtained from step (e) through rapid amplification of cDNA ends technique (RACE) using different set of primers to get the full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers comprising:
Forward Primer (GSP1): 5′-CCAGTGGATTTGCTAAGCTCATGTCCA-3′ Reverse Primer (NES1): 5′-GTCATCAGGGTCTGCATGGACAACAAC-3′ Forward Primer (GSP2): 5′-ATGGTTGCATGTCAACTGGACCACATT-3′ Reverse Primer (NES2): 5′-TTGCATGTCAACTGGACCACATTTCAA-3′ SMART II A Oligonucleotide: 5′AAGCAGTGGTATCAACGCAGAGTACGCGGG-3′ 3′-RACE CDS Primer A (3′-CDS): 5′AAGCAGTGGTATCAACGCAGAGTAC(T)30N-1N-3′ 5′-RACE CDS Primer (5′-CDS) 5′-(T)25N-1N-3′ Universel Primer Mix A (UPM):Long: 5′TAATACGACTCACTATAGGGCAAGCAGTGGTATCAACGCAGAGT-3′ Universel Primer Mix A (UPM):Short: 5′-CTAATACGACTCACTATAGGGC-3′ Nested Universal Primer A (NUP): 5′-AAGCAGTGGTATCAACGCAGAGT-3′ - h) amplifying the coding sequence of Superoxide dismutase (SOD) of SEQ ID No. 3 using a set of primers designed from start and stop codon of full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers have the following sequences:
Forward Primer: 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ Reverse Primer: 5′-TCATCCTTGAAGGCCAATAATACCA-3′ -
- i) cloning the amplified product obtained from step (g) into
pQE 30 expression vector followed by the transformation it into competent E.coli cells to get an expression construct; - j) isolating the plasmid DNA by conventional method followed by sequencing to confirm the said SOD gene.
- i) cloning the amplified product obtained from step (g) into
- In an embodiment of the present invention, the polyclonal antibodies were raised against the purified SOD and used for cDNA library screening synthesized from young leaf mRNA.
- In another embodiment of the present invention, library was screened and positive cDNA clones were amplified by polymerase chain reaction (hereinafter called as PCR) and two PCR products were obtained. These were sequenced and approximately 85% of the gene encoding SOD was obtained.
- Further, in another embodiment of the present invention, the sequences of the said cDNA clones does not have the start and end codon and smaller by 21%.
- In yet another embodiment of the present invention, primers were designed based on the sequences of positive cDNA clones and the rapid amplification of cDNA ends technique (hereinafter called as RACE) was employed to amplify the SOD full length gene.
- In still another embodiment of the present invention, the said SOD gene is sequenced and analyzed comprising the sequences set forth in SEQ ID No. 2.
- In still another embodiment of the present invention, the said full length SOD gene contains 856 nucleotide bases.
- In still another embodiment of the present invention, the said full length SOD gene has entire coding sequence along with pre- and post-coding sequences.
- In still another embodiment of the present invention, a set of primers are designed based on the full length SOD gene to amplify the superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3.
- In still another embodiment of the present invention, the said coding cDNA comprises 459 nucleotide bases.
- In still another embodiment of the present invention, said SOD gene is ligated into a vector to yield a recombinant plasmid which upon transformation into a suitable E. coli host resulted into a clone.
- In still another embodiment of the present invention, the said coding sequence of SOD gene of SEQ ID No. 3 corresponding to polynucleotides encoding Superoxide dismutase (SOD) enzyme.
- Further, the present invention also provides an expression construct included sequences encoding a selectable marker and a terminator sequence.
- In the present invention, leaves of Potentilla plant growing at Kunzum Pass (altitude 4517 m; 32° 24′ N; 077° 38′ E) in Lahaul and Spiti district of Himachal Pradesh in Western Himalaya of India were collected and stored in liquid nitrogen. We had earlier reported in our U.S. Pat. NO. 6,485,950 that the leaves of this plant has SOD that is autoclavable and functions at sub-zero temperature. Thus the gene encoding such a SOD was identified, isolated and cloned in E.coli by techniques well known and routinely practiced in the art. The present SOD gene was sequenced and analyzed for its sense orientation, comprising the sequences set forth in SEQ ID No;2. The term “sense” as used herein, refers to a substantial run of RNA bases having essentially the same bases as a specific RNA sequence (e.g., mRNA). The invention also embraced polynucleotides encoding the amino acid sequences set out in SEQ ID No. 1. The invention also provided host cells, comprising a polynucleotide of the invention in a manner that permits expression of the encoded SOD polypeptide. Suitable host cells for transformation with the SOD gene of the invention include bacterial cells e.g. E. coli. Polynucleotides of the invention may be introduced into the host cell as a part of a circular plasmid using the well known methods for introducing DNA into the host cell and routinely practiced in the art. Host cells of the invention are a valuable source for industrial scale production of recombinant SOD.
- Polyclonal antibody, in the present invention refers to an antibody produced in the normal immune system in response to an antigen consists of a number of closely related, but not identical proteins).
- Vector, in the present invention refers to the sequence of DNA capable of accepting foreign DNA and take the form of a circular plasmid DNA that shows resistance to a given antibiotic The gene sequence of the invention was compared with the SOD reported from other plants to figure out the uniqueness of the gene (
FIG. 2 ). Sequences unique to the polypeptides of the invention are recognizable through sequence comparison to other known polypeptides, and can be identified through use of alignment programs routinely utilized in the art, e.g., those made available in public sequence databases (FIG. 3 ). This suggested that the sequence obtained were incomplete. SEQ ID No;3 however, shared at least 80%, at least 82%, at least 83%, at least 85%, at least 86% sequence homology with SOD genes reported from other plants. Percent sequence “homology” with respect to polynucleotides of the invention is defined herein as the percentage of nucleotide bases in the candidate sequence that are identical to the nucleotides in the SOD coding sequence after aligning the sequences, if necessary, to achieve the maximum percent sequence identity. - It is cumulative effect/combination of amino acids for the entire 100% amino acid composition that this property is observed. This entire composition provides this protein the effect that protein has this effect.
- The following examples are given by way of illustration of the present invention and should not be construed to limit the scope of the present invention.
- Raising Antibodies Against SOD in Rabbit
- Polyclonal antibodies against purified protein were raised in one-year-old male rabbit (New Zealand type). Purified SOD protein (100 μg in 500 μl of potassium phosphate buffer; pH, 7.0) was emulsified in 1 ml of Freund's complete adjuvant and administered intramuscularly using disposable syringe. Complete Freund's adjuvant was obtained from Bangalore Genei, India that contained paraffin oil, mannide monooleate as an emulsifier and heat killed Mycobacterium tuberculosis. After 7th days of primary injection, a booster dose (1 ml, containing 60 μg of purified protein emulsified in 1 ml of incomplete adjuvant) was administered. Adjuvant (500 μl) was thoroughly emulsified with the purified enzyme (500 μl: 100 μg) to obtain a stable antigen-adjuvant emulsion by rapidly withdrawing and expelling the antigen-adjuvant mix using a 22 gauge needle fitted to a sterile syringe. Complete emulsification was tested by placing a drop of the mixture onto a still surface of distilled water. The intactness of the droplet assures complete mixing. Antigen-adjuvant mixture (800 μl) was injected in thigh muscles of rabbit using a 22 gauge needle. Blood was collected from heart of the rabbit and allowed to clot for 2 hours at room temperature. After overnight storage at 4° C., the edges of the clot were rimmed using a Pasture pipette and centrifuged at 150×g for 5 min. Supernatant was collected and centrifuged for 15 min at 350×g to remove cell debris. Sodium azide was added to a concentration of 0.025% and the serum was stored at 4° C. After second booster dose, a small amount of blood was collected to test for the presence of the antibody using Ouchterlony Double Diffussion (hereinafter known as ODD) as described by Kanematsu, S. and Asada, K.(1990) Plant Cell Physiol. 31: 99-112. Thus, in a 85 mm petri plate, 1.5% agar prepared in 0.15 M NaCl, 20 mM potassium phosphate of pH 7.0 and 0.02% sodium azide was poured to a thickness of 3 mm. Antigen (20 μl containing 4 μg of protein) and antibody were loaded into the 3 mm diameter well cut with the help of cork-borer. Petri plate was covered and kept in a humid environment for 16-24 hour at 37° C. and examined for line of immune precipitation.
- RNA Isolation, Quantification of RNA, Gel-Electrophoresis and Purification of Poly A+ mRNA from Total RNA
- Ribonucleic acid (hereinafter known as, RNA) from young leaf tissue of Potentilla was isolated using the modified guanidine hydrochloride procedure (Lal. L., Sahoo. R., Gupta. R. K., Sharma. P. and kumar. S. Plant Molecular Biology Reporter 19: 181a-181f.). Leaf tissue (500 mg) was ground in liquid nitrogen to fine powder. Powder was transferred into a new mortar containing 5 ml of the GH buffer (8M guanidine hydrochloride, 20 mM EDTA, 20 mM MES, 100 mM βME) and was ground further. Resulting homogenate was transferred to an oak-ridge tube containing equal volume of phenol:chloroform:isoamylalcohal (25:24:1). Phases were emulsified by vortexing and separated by centrifugation at 10,000 rpm for 20 min (7° C.). Upper aqueous phase was transferred to a fresh oak-ridge tube and extracted with the equal volume of chloroform:isoamylalcohal (24:1). Resulting upper aqueous phase was transferred to a corex tube and RNA was precipitated by adding 0.2 volume of 1 M acetic acid and 0.7 volume of chilled ethanol. The tubes were kept at −72° C. for 3 h. Precipitate was pelleted by centrifugation at 10,000 rpm for 10 min at 4° C. Pellet was washed thrice using 5 ml of 3 M sodium acetate (pH 5.2) followed by final washing with 70% chilled ethanol. Pellet was dried and dissolved in minimum volume of DEPC-treated autoclaved water. RNA was quantified by measuring absorbance at 260 nm and the purity was monitored by calculating the ratio of absorbance measured at 260 and 280 nm. A value >1.8 at 260/280 nm was considered ideal for the purity of RNA used in the present investigation. The formula used to calculate RNA concentration and yield was as follows:
Concentration of RNA (μg/ml)=A 260 (absorbance at 260 nm)×40×dilution factor
Total yield (μg)=concentration×volume of stock RNA sample - To check the integrity of RNA, 5-6 μg of RNA in 4.5 μl of DEPC treated autoclaved water was diluted with 15.5 μl of M1 solution (2 μl of 5× MOPS buffer, 3.5 μl of formaldehyde, and 10 μl of formamide [5× MOPS buffer: 300 mM sodium acetate, 10 mM MOPS (3-{N-morpholino]propanesulfonic acid}, 0.5 mM ethylene diamine tetra-acetic acid (EDTA)] and incubated for 15 minutes at 65° C. RNA was loaded onto 1.0% formaldehyde agarose-gel after adding 2 μl of formaldehyde-gel loading buffer [50% glycerol, 1 mM EDTA (pH, 8.0), 0.25% bromophenol blue, 0.25% xylene cyanol FF], and electrophoresed at 72 volts in 1× MOPS buffer (60 mM sodium acetate, 2 mM MOPS, 0.1 mM EDTA), (Sambrook, J., Fritsch, E. F. and Maniatis, T. 1989. Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Plainview, N.Y.).
- Poly-A mRNA was purified from the total RNA using dC10T30 oligonucleotides attached covalently to polystyrene-latex particles (Oligotex™, Qiagen Inc). Oligotex selectively binds mRNA with poly-A tail to allow purification leaving all other RNA species that lack poly-A tail. 1 mg of total RNA was used as the starting material for the isolation of the mRNA and manufacturer's instructions were followed during the procedure.
- Construction of a Directional Complementary DNA Library (Hereinafter Referred to cDNA Library)
- Poly-A+ mRNA was used to synthesize cDNA using TimeSaver™ cDNA synthesis kit (Amersham Pharmacia Biotech. USA). First strand was synthesized using MMLV-reverse transcriptase in the presence of a bifunctional primer [5′d(AAC TGG AAG AAT TCG CGG CCG CAG GAA T18)
p 3′] having an oligo (dT18) tract at the 3′-end of a restriction site for Not I. Second strand synthesis is initiated by DNA polymerase I after RNase H has nicked the RNA strand of the RNA:cDNA hybrid. The cDNA produced is extracted with phenol/chloroform and purified on a Sepharose CL-4B spun column. An Eco RI adaptor (5′-d[AATTCGGCACGAGG]-3′, [GCCGTGCTCC]p-5′) is ligated to other end of the cDNA. cDNA was digested with Not I to release site on oligo (dT18-Not I) primer. cDNA's with Eco RI and Not I overhangs were phosphorylated to disallow self-ligation but ligation to the dephosphorylated vector. - Bacteriophage λ vector (λ ExCell Not I/Eco RI/CIP) was selected for cloning of cDNA's with Eco RI and Not I overhang generated as above. λ ExCell is derived from a λ Charon vector engineered to contain an internal, linearized copy of pExCell. Following the construction and screening using the lawn cells (E. coli strain NM522), the bacteriophage containing the clone of interest were used to infect a special E. coli strain (NP66) that enables the in vivo release of pExCell, a circular, autonomously replicating pUC-based phagemid. In vivo excision of pExCell is accomplished by site-specific recombination between attL and attR sites that flank the phagemid within the λ ExCell DNA. NP66 carries the accessory proteins require for excision under the control of a thermo-inducible promoter. In vivo excision is accomplished by infection of NP66 with λ ExCell followed by growth at 39° C., which enables the expression of these accessory proteins.
- The ligated vector and the cDNA fragments were packaged in an in vitro packaging system (Ready to Go Lambda packaging kit, Amersham Pharmacia Biotech. USA). In vitro packaging system for lambda DNA uses single lysogen, which codes for all necessary packaging proteins. The extract was prepared from E.coli lysogen in which the prophage carries a cos mutation. The cos mutation is a deletion in the cos site which prevents the endogenous prophage from being packaged; the exogenous recombinant DNA is, however, efficiently packaged. Packaging extracts also lack Eco K and other DNA restriction systems that recognize methylated DNA, which results in the efficient packaging of methylated and unmethylated cDNA.
- Library Screening and Identification, Amplification and Purification of Positive Phage
- Library was screened using polyclonal antibodies raised against purified SOD as probe. Immobilized antibodies were detected using chemiluminescence based detection method (ECL™ western blotting analysis system, Amersham Inc.). The library was plated by making the serial dilutions of packaging reaction in SM buffer (100 mM NaCl, 8 mM MgSO4, 50 mM Tris-HCl and 0.01% gelatin). Autoclaved and dried nitrocellulose filter membranes fitting to the size of petri plate (82 mm) were used. Membranes were soaked in 10 mM isopropyl β-D-thiogalactopyranoside (hereinafter referred to IPTG) for 5 min, air-dried and used for screening. After 6 h incubation of the plated library or as the plaques started appearing, the plates were overlaid with IPTG-soaked nitrocellulose filters. The filters were overlaid by gently holding filters with blunt ended forceps at opposite edges and centering filter over plate, without trapping any air bubble. Filter was not moved once contact is made with the plate. The plates-filters (inverted) were incubated for another 4 h at 37° C. After incubation, the plates were marked with 18-gauge needle by puncturing asymmetrically for future alignment. Filters were removed from plates with protein side up. Positive plaques were selected using the correct orientation of the developed X-ray, filter and the plate. After marking plagues were cored out and placed in 300 μl of SM buffer for incubation at room temperature. After 2 h, it was centrifuged at 13,000×g for 10 min. The supernatant was collected in a fresh sterile tube followed by addition of 30 μl chloroform. The amplified phage was replated for secondary and tertiary screening. After tertiary screening the positive plaques were cored for in vivo phagemid release. For
primary screening 105 plaque forming unit (pfu) were taken and transferred to membrane. Membranes were hybridized with polyclonal antibody and developed as ECL instruction. Three strong positive clones were obtained and further taken for secondary screening which gave 70% positive signal. A few clones were taken for tertiary screening and this time all the clones gave 100% positive signal after tertiary screening. All the positive plaques were used to release the vector pExCell containing the cloned fragment. - In Vivo Release of Phagemid pExcell from Selected Clones
- Host cells were prepared from released strain of E.coli NP66 in 2× YT medium (2× YT medium: 12 g trypton, 24 g yeast extract and 5 g glycerol in 1 litre of final volume in distilled/deionized water) containing 50 μg/ml spectinomycin, 30 μg/ml of chloramphenicol and 0.2% maltose. The culture was grown overnight at 32° C. 5ml of 2× YT containing 50 μg/ml spectinomycin, 30 μg/ml of chloramphenicol and 0.2% maltose was incubated with 50 μl of the overnight culture. This culture was grown at 32° C. with shaking to an A600 of 0.5-0.8. and cells were harvested by centrifugation at 3000×g. The pellet was re-suspended NZCYM broth (NZCYM broth: 10 g casein hydrolysate, 5 g yeast extract, 5 g NaCl, 1 g casamino acid and 2 g MgSO4.7H2O in 1 litre of final volume in distilled/deionized water) containing 50 μg/ml spectinomycin to a final A600 of 2.0. Cells were used within 1 h. To release the pExCell, 100 μl of the prepared NP66 cells were placed in a 15 ml sterile glass tube and incubated at 39° C. for 20 min to allow for expression of the His proteins required for site-specific recombination between attL and attR sites. 100 μl of the phage SM solution was added from to the cells and incubated at 39° C. for an additional 20 min. To this NP66/phage mixture, 200 μl of 1 M sodium citrate was added to terminate the infection of NP66 with λ ExCell and 5 ml of pre-warmed (32° C.) 2× YT broth containing 50 μg/ml spectinomycin was added. The culture was incubated at 32° C. with moderate shaking for 1.5 h to yield ‘released culture’. To prepare overnight cultures for subsequent isolation of pExCell DNA, 50 μl of the released culture was incubated at 37° C. in 5 ml of LB medium (LB medium: 10 g trypton, 5 g yeast extract, 10 g sodium chloride in 1 litre of final volume in distilled/deionized water) containing 100 μg/ml ampicillin.
- Analysis and Sequencing of Cloned cDNA
- The cultures were streaked and the colonies were randomly picked up using a pipette tip. The colony was suspended in 50 μl of lysis buffer (colony lysis buffer: TE (Tris-
Cl 10 mM, 1 mM EDTA, pH 8.0) with 0.1% tween 20), boiled for 10 min in a water bath followed by snap cooling on ice. Plasmid released in the colony lysate was amplified using 0.2 μM of each ‘forward’(5′-GTTGTAAAACGACGGCCAGT-3′) and ‘reverse’ (5′-CACAGGAAACAGCTATGACC-3′) flanking primer, 20 μM of dNTPs and 1 Units of Thermus aquaticus (hereinafter referred to Taq) DNA polymerase (purchased from M/S. Qiagen, Germany) in 1× PCR buffer (20 mM Tris-Cl (pH, 8.4), 50 mM KCl, 1.5 mM MgCl2 ). In the present invention, dNTPs refere to deoxy nucleoside triphosphate which comprises of deoxyadenosine triphosphate (hereinafter referred to dATP), deoxyguanosine triphosphate (hereinafter referred to dGTP), deoxycytidine triphosphate (hereinafter referred to dCTP) and deoxythymidine triphosphate (hereinafter referred to dTTP). Thermocycler program consisted of 30 cycles of 94° C. for 40 sec, 52° C. for 1 min and 72° C. for 2 min. This was followed by a 5 min extension at 72° C. Amplified products were run on 1.2% agarose gel in 1× TAE buffer (TAE buffer: 0.04 M Tris-acetate, 0.002 M EDTA, pH 8.5) containing ethidium bromide (final concentration of 0.5 μg/ml) and analyzed for correct size of insert by comparing with standard DNA molecular weight marker. Plasmids were isolated using QIAGEN plasmid mini kit (Cat#12125). These were quantified, checked on 1% agarose gel and sequencing was performed using the BigDye terminator (version 3.1) cycle sequencing mix (Applied Biosystems, USA) on automated DNA sequencer (ABI Prism 310, Genetic Analyzer, Applied Biosystems, USA). Protocols were followed essentially as described by respective manufacturers. Sequencing primers used were ‘forward’ 5′-INFORMATION FOR SEQ ID NO:4 (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 365 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: double (D) TOPOLOGY: circular (ii) MOLECULE TYPE: cDNA (iii) SEQUENCE DESCRIPTION: SEQ ID NO:4 5′CAAGAGGGAGATGGCCCAACTACTGTGACCGGAAACATTTCTGGCCTC AAGCCTGGGCTTCATGGTTTCCATGTTCATGCTCTTGGGGACACAACCAA TGGTTGCATGTCAACTGGACCACATTTCAATCCTGCTGGCAAAGAGCATG GGTCTCCTGAAGATGAGACTCGTCATGCTGGTGATCTTGGAAATATCACT GTTGGGGATGACGGAACTGCTTGCTTCACAATTGTTGACAAACAGATTCC TCTCACTGGACCACACTCTATCATTGGTAGGGCTGTTGTTGTCCATGCAG ATCCTGATGACCTTGGCAAGGGTGGACATGAGCTTAGCAAATCCACTGGA AATGCTGGTGGCAGGAT 3′ - Sequence mentioned in example 6 was searched for homology in the gene databases available at URL www.ncbi.nlm.nih.gov. using Basic Local Alignment Search Tool (hereinafter called as BLAST). It was clear from the results that the sequence had a homology between 80-90% with the SOD sequences submitted in the databases.
- Cloning of Full Length Gene Using Rapid Amplification of cDNA Ends (Hereinafter Referred to RACE)
- Rapid amplification of cDNA ends (RACE) was used to isolate full length SOD gene from Potentilla atrosanguinea. RACE amplifies DNA sequences from a messenger RNA template between a defined internal site and unknown sequences of either the 3′ or 5′ end (Frohman, M. A., Dush. M. K. and Martin, G. R. (1988) Proc. Natl. Acad. Sci. USA 85: 8998-9002; U.S. Pat. Nos. 5,962,271 and 5,962,272). A set of gene specific primers were used to generate 5′ and 3′ ends of the gene separately. The partial cDNA sequence (SEQ ID No; 1) was used to design two sets of primers. Primers were designed such that the amplified 5′ and 3′ ends overlap each other over a small stretch of nucleotides. For 5′ RACE, a gene specific primer (hereinafter referred to GSP1),5′-CCAGTGGATTTGCTAAGCTCATGTCCA-3′ for primary PCR and one nested gene specific primer (hereinafter referred to NES1), 5′-GTCATCAGGGTCTGCATGGACAACAAC-3′ for secondary PCR (RACE). It has been used 1 μl of 10 μM nested primers stock for secondary PCR. For 3′ RACE a gene specific primer (hereinafter referred to GSP2), 5′-ATGGTTGCATGTCAACTGGACCACATT-3′ for primary PCR and one nested primer (hereinafter referred to NES2), 5′-TTGCATGTCAACTGGACCACATTTCAA-3′ were designed. Primers were designed such that the amplified 5′ and 3′ ends overlap each other over a small stretch of nucleotides.
- The cDNA for 5′-RACE was synthesized using a modified lock-docking oligo(dT) primer and SMART II A oligo (dT) primer. The modified oligo (dT) primer, termed the 5′-RACE CDS Primer (5′-CDS) has two degenerate nucleotide positions at the 3′ end.
- 1 μg of total RNA was reverse transcribed in separate reactions to yield 5′ and 3′ RACE ready cDNA using an enzyme known as reverse transcriptase. For 5′ cDNA synthesis, the reaction was carried out using 1 μM of 5′-CDS primer in a reaction mixture containing RNA and 1 μM SMART II oligo (dT) primer. The 3′-RACE cDNA is synthesized using a traditional reverse transcription procedure, but with a special oligo (dT) primer. This 3′-RACE CDS Primer A (3′-CDS) primer includes the lock-docking nucleotide positions as in the 5′-CDS and also has a portion of the smart sequence at its 5′ end. Sterile H2O was added to a final volume of 5 μl for each reaction, mixed and centrifuged. The reaction mix was incubated at 70° C. for 2 min and cooled on ice for 2 min. First-strand buffer (50 mM Tris-Cl (pH, 8.3), 75 mM KCl and 6 mM MgCl2 ), 1 mM dNTPs, 2mM DTT and reverse transcriptase were added to each reaction and incubated at 42° C. for 1.5 hr in an air incubator. Diluted the first-strand reaction product with 100 μl of Tricine-EDTA buffer (10 mM Tricine-KOH (pH 8.5), 1.0 mM EDTA) and heated tubes at 72° C. for 7 min. (Reverse transcription system was a component of SMART RACE cDNA amplification kit from BD Biosciences, USA).
- Sequences of Primers Used for RACE Were as Follows (Purchased from BD Biosciences, USA as a Part of RACE Kit).
Primer Primer Sequence SMART II A Oligonucleotide 5′-AAGCAGTGGTATCAACGCAGA GTACGCGGG-3′ 3′-RACE CDS Primer A 5′-AAGCAGTGGTATCAACGCAGA (3′-CDS) GTAC(T)30N-1N-3′ 5′- RACE CDS Primer 5′-(T)25N-1N-3′ (5′-CDS) 10X Universel Long: Primer Mix A (UPM) 5′-TAATACGACTCACTATAGGGC AAGCAGTGGTATCAACGCAGAGT- 3′ Short: 5′-CTAATACGACTCACTATAGGG C-3′ Nested Universal Primer A 5′-AAGCAGTGGTATCAACGCAGA (NUP) GT-3′ - 5′ and 3′ RACE cDNA were amplified using 0.2 μM GSP1, GSP2 primer and 1× universal primer (UPM), 0.2 mM dNTP and 1× BD polymerase mix. Thermocycler program consisted of 30 cycles of 94° C. for 30 sec, 68° C. for 30 sec and 72° C. for 3 min. The reaction was up-scaled to 50 μl and after the completion of PCR, 45 μl of PCR sample was run on 1.2% agarose gel in TAE buffer containing ethidium bromide (final concentration of 0.5 μg/ml) Rest of the amplified product was stored at −20° C. for secondary PCR if needed. Amplicons were cut from the gel and DNA was eluted from the gel using QIAEX II gel extraction kit from M/S Qiagen, Germany following the manufacturer's instructions. The purified DNA was cloned in pGEM-T easy vector (Promega, USA), plasmids were isolated using the Qiagen plasmid mini-isolation kit, and sequencing was performed using the BigDye terminator (version 3.1) cycle sequencing mix (Applied Biosystems, USA) on an automated DNA sequencer (
ABI Prism 310, Genetic Analyzer, Applied Biosystems). Protocols were followed essentially as described by respective manufacturers. The RACE products were analyzed by BLAST.(3) INFORMATION FOR SEQ ID NO:2 (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 856 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: double (D) TOPOLOGY: circular (ii) MOLECULE TYPE: cDNA (iii) SEQUENCE DESCRIPTION: SEQ ID NO:2 5′ACGGGGGGGGGACTGAAATAAATAGAGAGGGTCATAGTCACATTTGCA TTTAGGTATCTGATTCCATTCACAAACCTCCAACTCCCACCTCTCTCTCT ATTTCTCTTCATCTTCATCATCTTAGGGTGCACTGAGATCACTTTGAAAC ATGGCAAAGGGCGTTGCTGTACTTAGCTCCAGTGAGGGTGTTGCTGGAAC TATCCTCTTTACCCAAGAGGGAGATGGCCCAACTACTGTGACCGGAAACA TTTCTGGCCTCAAGCCTGGGCTTCATGGTTTCCATGTTCATGCTCTTGGG GACACAACCAATGGTTGCATGTCAACTGGACCACATTTCAATCCTGCTGG CAAAGAGCATGGGTCTCCTGAAGATGAGACTCGTCATGCTGGTGATCTTG GAAATATCACTGTTGGGGATGACGGAACTGCTTGCTTCACAATTGTTGAC AAACAGATTCCTCTCACTGGACCACACTCTATCATTGGTAGGGCTGTTGT TGTCCATGCAGATCCTGATGACCTTGGCAAGGGTGGACATGAGCTTAGCA AATCCACTGGAAATGCTGGTGGCAGGATAGCTTGTGGTATTATTGGCCTT CAAGGATGAACTGGACCAGGGAGCGAAACACAGGCATCTTGTTGAATTAA AACTTGAGATATTAGCGAACTCTTCGGAATTGAGTATTGAAACAAGGAAT ACATTTGTCATTACCAATACGTTTGGCTTAGACCTGTATTCTGTATCTCA ATAGTTTTCTGTGTGGTTGTTTGACAGTTATTTGTGCTCAGGCTATTTCA AAGGGATAAACACAGTAACTTTCTTGCTTTGACAAAAAAAAAAAAAAAAA AAAAAAAA 3′ - Amplification of Coding Sequence (Hereinafter Known as CDS) of SOD and Cloning into an Expression Vector
- CDS of SOD was amplified by PCR using the
forward primer 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ andreverse primer 5′-TCATCCTTGAAGGCCAATAATACCA-3′ designed from start codon and stop codon. The amplified product was cloned intopQE 30 expression vector and transformed into competent E. coli cells. The plasmid was isolated using the standard plasmid isolation protocol (Sambrook, J., Fritsch, E. F. and Maniatis, T. 1989. Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Plainview, N.Y.) and sequencing was performed using the BigDye terminator (version 3.1) cycle sequencing mix (Applied Biosystems, USA) on an automated DNA sequencer (ABI Prism 310, Genetic Analyzer, Applied Biosystems) to confirm cloning of insert. Protocols were followed essentially as described by the manufacturer.(4) INFORMATION FOR SEQ ID NO: 3 (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 459 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: double (D) TOPOLOGY: circular (ii) MOLECULE TYPE: cDNA (iii) SEQUENCE DESCRIPTION: SEQ ID NO: 3 5′ ATGGCAAAGGGCGTTGCTGTACTTAGCTCCAGTGAGGGTGTTGCTGG AACTATCCTCTTTACCCAAGAGGGAGATGGCCCAACTACTGTGACCGGAA ACATTTCTGGCCTCAAGCCTGGGCTTCATGGTTTCCATGTTCATGCTCTT GGGGACACAACCAATGGTTGCATGTCAACTGGACCACATTTCAATCCTGC TGGCAAAGAGCATGGGTCTCCTGAAGATGAGACTCGTCATGCTGGTGATC TTGGAAATATCACTGTTGGGGATGACGGAACTGCTTGCTTCACAATTGTT GACAAACAGATTCCTCTCACTGGACCACACTCTATCATTGGTAGGGCTGT TGTTGTCCATGCAGATCCTGATGACCTTGGCAAGGGTGGACATGAGCTTA GCAAATCCACTGGAAATGCTGGTGGCAGGATAGCTTGTGGTATTATTGGC CTTCAAGGATGA 3′ (5) INFORMATION FOR Pro SEQ ID NO: 1 (i) SEQUENCE CHARACTERISTICS: (A) LENGTH: 152 amino acids (B) TYPE: amino acid (ii) MOLECULE TYPE: polypeptide (iii) SEQUENCE DESCRIPTION: Pro SEQ ID NO: 1 MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALG DTTNGCMSTGPHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVD KQIPLTGPHSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRIACGIIGL QG - Induction and Purification of Expressed Protein
- E. coli containing SOD gene from Potentilla was grown at 37° C. in 100 ml of LB medium with 100 μg ml−1 and 25 μg ml−1 kanamycin. When that culture had grown to an absorbance of 0.6 at 600 nm, IPTG was added to a final concentration of 1 mM. CuSO4 and ZnSO4 were added to a final concentration of 100 ppm and 2 ppm, respectively. After inducing the expression of the SOD protein for 5 h at 37° C., cells were harvested, washed and resuspended in 4 ml of lysis buffer (50 mM NaH2PO4 buffer, pH 8.0, containing 300 mM NaCl and 10 mM imidazole). The cell suspension was sonicated, and the lysate was cleared by centrifugation at 12000 g and 4° C. for 20 min. The supernatant was then poured into the column loaded with nickel-nitrilotriacitic acid (Ni-NTA) agarose, washed with wash buffer (50 mM NaH2PO4 buffer, pH 8.0, containing 300 mM NaCl and 20 mM imidazole), and SOD protein was eluted with elution buffer (50 mM NaH2PO4 buffer, pH 8.0, containing 300 mM NaCl and 250 mM imidazole). The purified SOD was evaluated by 10% SDS-PAGE using silver staining to visualize the protein (
FIG. 4A ). - The protein estimation was performed before and after autoclaving purified SOD that shows ±25% loss of protein. Since 50 μl of protein sample was used for assaying SOD activity, the loss in protein was calculated while calculating the enzyme activity. Reaction medium contained 0.05 M potassium phosphate buffer (pH, 7.0), 5.7×10−5 M nitroblue tetrazolium (hereinafter referred to NBT), 9.9×10−3 M methionine, 1.17×10−6 M riboflavin and 0.025% Triton X-100 in a total volume of 3.0 ml. Reaction (performed in a 30 ml glass vial) was initiated by illuminating the reaction with light intensity of 1000 μ Einstein/m2/second using a fiber optic light source (Nikon). The reaction was terminated after 2 min and the absorbance was read at 560 nm.
- A control reaction was always performed wherein all the steps and components were exactly the same as described above except that purified enzyme was replaced with equal volume of homogenizing buffer. Activity of SOD is expressed as per cent inhibition in color development as compared to the control reaction (higher the inhibition, higher the SOD activity). Activity data was shown in
FIG. 1 . - SOD Activity at Different Temperatures in Purified SOD
- The purified SOD enzyme was assayed at temperatures ranging between −10 to 80 ° C. in the buffer composition as described in Example 10 except that 50% glycerol was added in the reaction mixture to avoid freezing at low temperature. A glass beaker of 100 ml capacity was filled with either alcohol (for working at temperatures of −10, −5, 0° C.) or distilled water (for working at rest of the temperatures) was used to maintain the temperature of the reaction medium while assaying SOD. Reaction medium along with the enzyme was pre-equilibrated at desired temperature to avoid time lag in attaining the required temperature. As can be seen from
FIG. 1 that the enzyme showed highest activity (87.5% inhibition) at 0° C. The enzyme was functional even up to −10° C. (82% inhibition). The enzyme is expected at temperature lower than −10° C. - Control reactions, as mentioned in Example 10, were always performed at all the temperatures.
- Localization of SOD by Activity Staining of Native Gel
- The purified SOD was localized on 10% polyacrylamide gel by activity staining as described by Beauchamp and Fridovich (Anal. Biochem. 1971; 44: 246-287). After electrophoresis, the gel was rinsed with distilled water followed by 30 min incubation in 50 ml phosphate buffer (50 mM; pH 7.0) containing 2.5 mM NBT in dark at room temperature. Gel was then immersed in 1.17×10−6 M riboflavin for 20 min, followed by exposure to light source (Nikon). Light exposure led to photogeneration of O2 −, which converts NBT into insoluble purple colored formazan. The purple color was developed throughout the gel except for the location where SOD was localized as shown in
FIG. 4B . - The main advantages of the present invention are:
-
- 1. SOD gene has been cloned from Potentilla that is autoclavable and functions at sub-zero temperature.
- 2. SOD gene that is isolated from Potentilla has been made to express in E. coli.
- 3. SOD gene from Potentilla that is made to express in E.coli leading to synthesis of SOD protein that is autoclavable.
- 4. SOD gene from Potentilla that is made to express in E.coli leading to synthesis of SOD protein that is autoclavable, also functions at sub-zero temperature.
Claims (19)
1. Superoxide dismutase (SOD) cDNA of SEQ ID No. 2 obtained from Potentilla atrosanguinea, wherein the said cDNA comprising of 856 nucleotide bases.
2. Superoxide dismutase (SOD) cDNA as claimed in claim 1 , wherein the said cDNA has entire coding sequence along with pre- and post-coding sequences.
3. Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein the said coding cDNA comprising of 459 nucleotide bases.
4. Superoxide dismutase (SOD) polypeptide of SEQ ID No. 1, wherein the said polypeptide comprising of 152 amino acids.
5. Superoxide dismutase (SOD) polypeptide as claimed in claim 4 , wherein the said polypeptide is autoclavable.
6. Superoxide dismutase (SOD) polypeptide as claimed in claim 4 , wherein the said polypeptide is functional at temperature range of <−10° C. to +80° C.
7. A set of primers useful for the amplification of Superoxide dismutase (SOD) gene coding cDNA of SEQ ID No. 3, wherein
Forward primer 5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ (SEQ ID NO: 5) and;
Rreverse primer 5′-TCATCCTTGMGGCCMTMTACCA-3′ (SEQ ID NO: 6)
8. A method of identifying and cloning of superoxide dismutase (SOD) gene of SEQ ID NO 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity, wherein the said method comprising the steps of:
Forward Primer:
5′-GTTGTAAAACGACGTGCCAGT-3′ (SEQ ID NO: 13)
Reverse Primer:
5′-CACAGGAAACAGCTATGACC-3′; (SEQ ID NO: 14)
Forward Primer (GSP1):
(SEQ ID NO: 7)
5′-CCAGTGGATTTGCTAAGCTCATGTCCA-3′
Reverse Primer (NES1):
(SEQ ID NO: 8)
5′-GTCATCAGGGTCTGCATGGACAACAAC-3′
Forward Primer (GSP2):
(SEQ ID NO: 9)
5′-ATGGTTGCATGTCAACTGGACCACATT-3′
Reverse Primer (NES2):
(SEQ ID NO: 10)
5′-TTGCATGTCAACTGGACCACATTTCAA-3′
SMART II A Oligonucleotide:
(SEQ ID NO: 11)
5′AAGCAGTGGTATCAACGCAGAGTAC GCGGG-3′
3′- RACE CDS Primer A (3′- CDS):
(SEQ ID NO: 73)
5′AAGCAGTGGTATCAACGCAGA
GTAC (T)30 N−1N-3′
5′- RACE CDS Primer (5′- CDS)
(SEQ ID NO: 15)
5′- (T)25 N−1N- 3′
Universel Primer Mix A (UPM): Long:
(SEQ ID NO: 16)
5′TAATACGACTCACTATAGGGC
AAGCAGTG GTATCAACGCAGAGT-3′
Universel Primer Mix A (UPM): Short:
(SEQ ID NO: 17)
5′-CTAATACGACTCACTATAGG
GC-3′
Nested Universal Primer A (NUP):
(SEQ ID NO: 23)
5′-AAGCAGTGGTATCAACGCAGAGT-3′
Forward Primer:
5′-ATGGCAAAGGGCGTTGCTGTACTT-3′ (SEQ ID NO: 5)
Reverse Primer:
5′-TCATCCTTGAAGGCCAATAATACCA-3′ (SEQ ID NO: 6)
a) isolating the mRNA from leaves of potentialla;
b) synthesizing the cDNA from mRNA as obtained from step (a);
c) constructing a cDNA library of the DNA of potentilla followed by the cloning of the cDNA obtained from step (b) in a suitable vector preferably in bacteriophage;
d) screening the said library obtained from step (c) followed by the primary, secondary and tertiary screening for identification of positive cDNA clones;
e) isolating the DNA from positive cDNA clones obtained from step (d);
f) amplifying the said DNA using the primers comprising:
h) amplifying the ends of cDNA obtained from step (e) through rapid amplification of cDNA ends technique (RACE) using different set of primers to get the full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers comprising:
i) amplifying the coding sequence of Superoxide dismutase (SOD) of SEQ ID No. 3 using a set of primers designed from start and stop codon of full length desired Superoxide dismutase (SOD) DNA of SEQ ID NO. 2 wherein the said primers have the following sequences:
j) cloning the amplified product obtained from step (g) into pQE 30 expression vector followed by the transformation it into competent E.coli cells to get an expression construct;
k) isolating the plasmid DNA by conventional method followed by sequencing to confirm the said SOD gene.
9. A method as claimed in claim 9 , wherein the polyclonal antibodies were raised against the purified SOD and used for cDNA library screening synthesized from young leaf mRNA.
10. A method as claimed in claim 9 , wherein the 105 plaque forming units (pfu) are taken for primary screening.
11. A method as claimed in claim 11 , wherein three strong positive clones are obtained from the primary cloning.
12. A method as claimed in claim 12 , wherein the said positive clones are taken for secondary screening which gives about 70% positive clones.
13. A method as claimed in claim 13 , wherein the said positive clones are randomly taken for tertiary screening which gives 100% positive signal after tertiary screening.
14. A method as claimed in claim 9 , wherein the said RACE Primers are designed such that the amplified 5′ and 3′end overlap each other over a small stretch of nucleotides.
15. A method as claimed in claim 9 , wherein the said full length SOD gene of SEQ ID No. 2 contains 856 nucleotide bases.
16. A method as claimed in claim 16 , wherein the said full length SOD gene of SEQ ID No. 2 has entire coding sequence along with pre- and post-coding sequences
17. A method as claimed in claim 9 , wherein the said coding cDNA of SEQ ID No. 3 comprises 459 nucleotide bases.
18. A method as claimed in claim 18 , wherein the said coding sequence of SOD gene of SEQ ID No. 3 corresponding to polynucleotides encoding Superoxide dismutase (SOD) enzyme.
19. An expression construct comprises a nucleotide sequence of superoxide dismutase (SOD) gene of SEQ ID NO 3 which codes for a polypeptide of SEQ ID No. 1 having Superoxide dismutase enzyme activity, a selectable marker and a terminator sequence.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US12/315,301 US7888088B2 (en) | 2006-03-31 | 2008-12-02 | Superoxide dismutase (SOD) gene and a method of identifying and cloning thereof |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
IN928DE2006 | 2006-03-31 | ||
IN0928/DEL/2006 | 2006-03-31 |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/315,301 Division US7888088B2 (en) | 2006-03-31 | 2008-12-02 | Superoxide dismutase (SOD) gene and a method of identifying and cloning thereof |
Publications (1)
Publication Number | Publication Date |
---|---|
US20070269811A1 true US20070269811A1 (en) | 2007-11-22 |
Family
ID=37682704
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/499,505 Abandoned US20070269811A1 (en) | 2006-03-31 | 2006-08-04 | Superoxide dismutase (SOD) gene and a method of identifying and cloning thereof |
US12/315,301 Active 2027-02-09 US7888088B2 (en) | 2006-03-31 | 2008-12-02 | Superoxide dismutase (SOD) gene and a method of identifying and cloning thereof |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/315,301 Active 2027-02-09 US7888088B2 (en) | 2006-03-31 | 2008-12-02 | Superoxide dismutase (SOD) gene and a method of identifying and cloning thereof |
Country Status (6)
Country | Link |
---|---|
US (2) | US20070269811A1 (en) |
EP (1) | EP2004811A1 (en) |
CN (1) | CN101437940B (en) |
AU (1) | AU2006341292B2 (en) |
BR (1) | BRPI0621501A2 (en) |
WO (1) | WO2007113615A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN115896048A (en) * | 2022-12-22 | 2023-04-04 | 河北纳科生物科技有限公司 | Recombinant human Cu, zn-SOD with high enzyme activity and good stability, and preparation method and application thereof |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP2268661B1 (en) | 2008-03-31 | 2017-11-08 | Council of Scientific & Industrial Research | Method of cloning stable stress tolerant superoxide dismutase using degenerate primers |
CN106290871B (en) * | 2015-07-24 | 2018-04-03 | 北京华宇亿康生物工程技术有限公司 | A kind of latex enhancing immune turbidimetry kit for being used to detect SOD in serum |
CN111254125B (en) * | 2020-04-30 | 2020-08-25 | 中国农业大学 | Superoxide dismutase and preparation method thereof, superoxide dismutase oral liquid and solid preparation |
CN114507751B (en) * | 2022-03-16 | 2023-07-21 | 新疆农业大学 | Molecular marker related to superoxide dismutase activity of wheat seeds and application thereof |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6485950B1 (en) * | 2000-07-14 | 2002-11-26 | Council Of Scientific And Industrial Research | Isozyme of autoclavable superoxide dismutase (SOD), a process for the identification and extraction of the SOD in cosmetic, food and pharmaceutical compositions |
-
2006
- 2006-08-01 EP EP06779914A patent/EP2004811A1/en not_active Ceased
- 2006-08-01 BR BRPI0621501-7A patent/BRPI0621501A2/en not_active Application Discontinuation
- 2006-08-01 CN CN200680054556.2A patent/CN101437940B/en active Active
- 2006-08-01 WO PCT/IB2006/002092 patent/WO2007113615A1/en active Application Filing
- 2006-08-01 AU AU2006341292A patent/AU2006341292B2/en active Active
- 2006-08-04 US US11/499,505 patent/US20070269811A1/en not_active Abandoned
-
2008
- 2008-12-02 US US12/315,301 patent/US7888088B2/en active Active
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6485950B1 (en) * | 2000-07-14 | 2002-11-26 | Council Of Scientific And Industrial Research | Isozyme of autoclavable superoxide dismutase (SOD), a process for the identification and extraction of the SOD in cosmetic, food and pharmaceutical compositions |
US7037697B2 (en) * | 2000-07-14 | 2006-05-02 | Council Of Scientific & Industrial Research | Isozyme of autoclavable superoxide dismutase (SOD), a process for the identification and extraction of the SOD and use of the said SOD in cosmetic, food, and pharmaceutical compositions |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN115896048A (en) * | 2022-12-22 | 2023-04-04 | 河北纳科生物科技有限公司 | Recombinant human Cu, zn-SOD with high enzyme activity and good stability, and preparation method and application thereof |
Also Published As
Publication number | Publication date |
---|---|
AU2006341292A2 (en) | 2013-01-31 |
BRPI0621501A2 (en) | 2011-12-13 |
US7888088B2 (en) | 2011-02-15 |
CN101437940A (en) | 2009-05-20 |
AU2006341292A1 (en) | 2007-10-11 |
EP2004811A1 (en) | 2008-12-24 |
AU2006341292B2 (en) | 2013-02-07 |
WO2007113615A1 (en) | 2007-10-11 |
CN101437940B (en) | 2015-01-21 |
US20100261268A1 (en) | 2010-10-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20040162420A1 (en) | Cloning of cytochrome p450 genes from nicotiana | |
US7888088B2 (en) | Superoxide dismutase (SOD) gene and a method of identifying and cloning thereof | |
JP2013539965A (en) | Bacteriophage lytic enzyme as an alternative antibacterial agent | |
WO2006017960A1 (en) | A detoxifizyme having activity of transforming aflatoxin and the gene encodes thereof | |
CN110106558A (en) | The screening system and cloning identification method of Agasicles hygrophila heat shock protein gene | |
CN109337884B (en) | Pyruvate kinase gene and application thereof | |
CN112175980A (en) | Method for improving activity of polymerase large fragment by site-directed mutagenesis and application | |
WO2023019871A1 (en) | Effect of flavonoid glycoside in resistance of rice to weeds | |
JP2011103864A (en) | Gene encoding protein having deoxynivalenol and nivalenol decomposing activity | |
JP2011103863A (en) | Gene encoding protein having deoxynivalenol decomposing activity | |
CN112877306B (en) | Super-heat-resistant glucose oxidase AtGOD and gene and application thereof | |
CN115074361A (en) | Strong promoter from fungus and application thereof | |
EP2268661B1 (en) | Method of cloning stable stress tolerant superoxide dismutase using degenerate primers | |
JP2000175698A (en) | Pyranose oxidase-containing reagent for measuring pyranose | |
KR102125235B1 (en) | New Bacteriophage for Prevention and Treating the Chicken Escherichia coli and Antibacterial Compositions Containing the Same | |
WO1997015656A1 (en) | A soybean peroxidase gene family and an assay for detecting soybean peroxidase activity | |
Ibrahim et al. | Determination of the optimal conditions of cloning Aerolysin gene from the common carp pathogen Aeromonas hydrophila in Escherichia coli BL21 | |
CN112779238A (en) | DNA polymerase mixture for hepatitis C virus detection | |
CN112592905A (en) | DNA polymerase mixture for novel coronavirus detection | |
CN112779237A (en) | DNA polymerase mixture for hepatitis B virus detection | |
KR100417805B1 (en) | Plant cDNA GCYC1, which endows high temperature stress resistance in bacteria or eukaryotic cells | |
CN115896048A (en) | Recombinant human Cu, zn-SOD with high enzyme activity and good stability, and preparation method and application thereof | |
CN115044599A (en) | Streptococcus agalactiae strain delta ess SC and construction method and application thereof | |
CN116536280A (en) | 2-ketoglutarate-dependent dioxygenase and application thereof | |
JP2010183872A (en) | New peroxidase |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: COUNCIL OF SCIENTIFIC AND INDUSTRIAL RESEARCH, IND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BHARDWAJ, PARDEEP K.;SAHOO, RASHITA;KUMAR, SANJAY;AND OTHERS;REEL/FRAME:019639/0754 Effective date: 20070703 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |