US20030003101A1 - Treatment and diagnosis of prostate cancer - Google Patents

Treatment and diagnosis of prostate cancer Download PDF

Info

Publication number
US20030003101A1
US20030003101A1 US09/929,665 US92966501A US2003003101A1 US 20030003101 A1 US20030003101 A1 US 20030003101A1 US 92966501 A US92966501 A US 92966501A US 2003003101 A1 US2003003101 A1 US 2003003101A1
Authority
US
United States
Prior art keywords
biological agent
antibody
cells
label
specific membrane
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US09/929,665
Inventor
Neil Bander
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cornell Research Foundation Inc
Original Assignee
Cornell Research Foundation Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=26695548&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=US20030003101(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by Cornell Research Foundation Inc filed Critical Cornell Research Foundation Inc
Priority to US09/929,665 priority Critical patent/US20030003101A1/en
Publication of US20030003101A1 publication Critical patent/US20030003101A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57407Specifically defined cancers
    • G01N33/57434Specifically defined cancers of prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3069Reproductive system, e.g. ovaria, uterus, testes, prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10TECHNICAL SUBJECTS COVERED BY FORMER USPC
    • Y10STECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10S435/00Chemistry: molecular biology and microbiology
    • Y10S435/81Packaged device or kit
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10TECHNICAL SUBJECTS COVERED BY FORMER USPC
    • Y10STECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y10S435/00Chemistry: molecular biology and microbiology
    • Y10S435/975Kit

Definitions

  • the present invention relates to the treatment and diagnosis of prostate cancer with biological agents.
  • Prostate cancer is the most common cancer in men with an estimated 317,000 cases in 1996 in the United States. It is the second leading cause of death among men who die from neoplasia with an estimated 40,000 deaths per year. Prompt detection and treatment is needed to limit mortality caused by prostate cancer.
  • Imaging techniques such as computed tomography (“CT”) or magnetic resonance (“MR”) imaging are unable to distinguish metastatic prostate cancer involvement of lymph nodes by criterion other than size (i.e., >1 cm). Therefore, by definition, these imaging modalities are inherently insensitive in the detection of small volume ( ⁇ 1 cm) disease as well as non-specific in the detection of larger volume adenopathy.
  • CT computed tomography
  • MR magnetic resonance
  • serum acid phosphatase is elevated in about 65-90 percent of patients having carcinoma of the prostate with bone metastasis; in about 30 percent of patients without roentgenological evidence of bone metastasis; and in about only 5-10 percent of patients lacking clinically demonstrable metastasis.
  • WO 79/00475 to Chu et. al. describes a method for the detection of prostatic acid phosphatase isoenzyme patterns associated with prostatic cancer which obviates many of the above drawbacks.
  • practical problems are posed by the need for a source of cancerous prostate tissue from which the diagnostically relevant prostatic acid phosphatase isoenzyme patterns associated with prostatic cancer are extracted for the preparation of antibodies thereto.
  • prostate-specific antigen concentrations After surgery, if there are detectable serum prostate-specific antigen concentrations, persistent cancer is indicated. In many cases, prostate-specific antigen concentrations can be reduced by radiation treatment. However, this concentration often increases again within two years.
  • Radiation therapy has also been widely used as an alternative to radical prostatectomy.
  • Patients generally treated by radiation therapy are those who are older and less healthy and those with higher-grade, more clinically advanced tumors.
  • Particularly preferred procedures are external-beam therapy which involves three dimensional, conformal radiation therapy where the field of radiation is designed to conform to the volume of tissue treated; interstitial-radiation therapy where seeds of radioactive compounds are implanted using ultrasound guidance; and a combination of external-beam therapy and interstitial-radiation therapy.
  • Hormonal therapy is the main form of treating men with disseminated prostate cancer. Orchiectomy reduces serum testosterone concentrations, while estrogen treatment is similarly beneficial. Diethylstilbestrol from estrogen is another useful hormonal therapy which has a disadvantage of causing cardiovascular toxicity.
  • gonadotropin-releasing hormone agonists are administered testosterone concentrations are ultimately reduced.
  • Flutamide and other nonsteroidal, anti-androgen agents block binding of testosterone to its intracellular receptors. As a result, it blocks the effect of testosterone, increasing serum testosterone concentrations and allows patients to remain potent—a significant problem after radical prostatectomy and radiation treatments.
  • Cytotoxic chemotherapy is largely ineffective in treating prostate cancer. Its toxicity makes such therapy unsuitable for elderly patients.
  • prostate cancer is relatively resistant to cytotoxic agents.
  • mAbs radiolabeled monoclonal antibodies
  • mAbs offer the potential to enhance both the sensitivity and specificity of detecting prostatic cancer within lymph nodes and elsewhere. While many mAbs have previously been prepared against prostate related antigens, none of these mAbs were specifically generated with an imaging objective in mind. Nevertheless, the clinical need has led to evaluation of some of these mAbs as possible imaging agents.
  • the monoclonal antibodies developed for detection and/or treatment of prostate cancer recognize antigens specific to malignant prostatic tissues. Such antibodies are thus used to distinguish malignant prostatic tissue (for treatment or detection) from benign prostatic tissue. See U.S. Pat. No. 4,970,299 to Bazinet et al. and U.S. Pat. No. 4,902,615 to Freeman et al.
  • Horoszewicz “Monoclonal Antibodies to a New Antigenic Marker in Epithelial Prostatic Cells and Serum of Prostatic Cancer Patients,” Anticancer Research, 7:927-936 (1987) (“Horoszewicz”) and U.S. Pat. No. 5,162,504 to Horoszewicz describe an antibody, designated 7E11, which recognizes prostate specific membrane antigen (“PSMA”).
  • PSMA prostate specific membrane antigen
  • PSMA is an integral membrane protein known to have a short intracellular tail and a long extracellular domain.
  • Biochemical characterization and mapping (Troyer et al., “Biochemical Characterization and Mapping of the 7E11-C5.3 Epitope of the Prostate-specific Membrane Antigen,” Urol. Oncol., 1:29-37 (1995)) have shown that the epitope or antigenic site to which the 7E11 antibody binds is present on the intracellular portion of the molecule. Because antibody molecules do not, under normal circumstances, cross the cell membrane unless they bind to the extracellular portion of a molecule and become translocated intracellularly, the 7E11 antibody does not have access to its antigenic target site in an otherwise healthy, viable cell.
  • imaging using 7E11 is limited to the detection of dead cells within tumor deposits. Additionally, the therapeutic use of the 7E11 antibody is limited, because only cells that are already dead or tissue containing a large proportion of dead cells can be effectively targeted.
  • the present invention is directed to overcoming the deficiencies of prior art antibodies in diagnosing and treating prostate cancer.
  • One aspect of the present invention relates to a method of ablating or killing normal, benign hyperplastic, and cancerous prostate epithelial cells.
  • the process involves providing a biological agent which recognizes an extracellular domain of prostate specific membrane antigen.
  • the biological agent can be used alone or can be bound to a substance effective to kill the cells upon binding of the biological agent to the cells.
  • These biological agents are then contacted with the cells under conditions effective to permit both binding of the biological agent to the extracellular domain of the prostate specific membrane antigen and killing or ablating of the cells.
  • the biological agent binds to and is internalized with the prostate specific membrane antigen of such cells.
  • Preferred biological agents for use in the method of ablating or killing normal, benign hyperplastic, and cancerous prostate epithelial cells in accordance with the present invention are antibodies or binding portions thereof, probes, or ligands.
  • Another aspect of the present invention relates to a method of detecting normal, benign hyperplastic, and cancerous prostate epithelial cells or portions thereof in a biological sample.
  • This method involves providing a biological agent which binds to an extracellular domain of prostate specific membrane antigen.
  • the biological agent is bound to a label effective to permit detection of the cells or portions thereof upon binding of the biological agent to the cells or portions thereof.
  • the biological sample is contacted with the biological agent having a label under conditions effective to permit binding of the biological agent to the extracellular domain of the prostate specific membrane antigen of any of the cells or portions thereof in the biological sample.
  • the presence of any cells or portions thereof in the biological sample is detected by detection of the label.
  • the biological agent binds to and is internalized with the prostate specific membrane antigen of such cells.
  • Preferred biological agents for use in the method of detecting normal, benign hyperplastic, and cancerous prostate epithelial cells in accordance with the present invention are antibodies or binding portions thereof, probes, or ligands.
  • Another aspect of the present invention pertains to a biological agent that recognizes an extracellular domain of prostate specific membrane antigen.
  • the isolated biological agent binds to and is internalized with the prostate specific membrane antigen.
  • Preferred isolated biological agents which recognize an extracellular domain of prostate specific membrane antigen in accordance with the present invention are isolated antibodies or binding portions thereof, probes, or ligands. Hybridoma cell lines that produce monoclonal antibodies of these types are also disclosed.
  • the biological agents of the present invention recognize the extracellular domain of antigens of normal, benign hyperplastic, and cancerous prostate epithelial cells. Unlike the 7E11 antibody, which recognizes an epitope of prostate-associated antigens which are exposed extracellularly only after cell lysis, the biological agents of the present invention bind to antigenic epitopes which are extracellularly exposed in living prostate cells. Using the biological agents of the present invention, living, unfixed normal, benign hyperplastic, and cancerous prostate epithelial cells can be targeted, which makes treatment and diagnosis more effective. In a preferred embodiment, the biological agents of the present invention also bind to and are internalized with the prostate specific membrane antigen, which permits the therapeutic use of intracellularly acting cytotoxic agents.
  • FIG. 1 is an immuno-electron micrograph of gold-labeled monoclonal antibody J591 on the surface of LNCaP cells prior to incubation.
  • FIG. 2 is an immuno-electron micrograph of gold-labeled monoclonal antibody J591 after 5 minutes incubation at 37° C. LNCaP cells.
  • FIG. 3 is an immuno-electron micrograph of gold-labeled monoclonal antibody J591 after 10 minutes incubation at 37° C. LNCaP cells.
  • FIG. 4 is an immuno-electron micrograph of gold-labeled monoclonal antibody J591 after 15 minutes incubation at 37° C. LNCaP cells.
  • FIG. 5 is an immuno-electron micrograph of gold-labeled monoclonal antibody J591 after 15 minutes at 37° C. showing J591 within endosomes.
  • FIG. 6 summarizes the sequencing strategy of the heavy chain of monoclonal antibody J591.
  • FIG. 7 shows the nucleotide sequence of the heavy chain of monoclonal antibody J591 (designated SEQ. ID. No. 1), the nucleotide sequence of the corresponding reverse, non-coding strand (designated SEQ. ID. No. 2), and the corresponding deduced amino acid sequences (designated SEQ. ID. Nos. 3, 4, and 5).
  • FIG. 8 is a comparison of the heavy chain of monoclonal antibody J591 with the consensus sequence for Mouse Heavy Chains Subgroup IIA.
  • FIG. 9 summarizes the sequencing strategy of the kappa light chain of monoclonal antibody J591.
  • FIG. 10 shows the nucleotide sequences of the kappa light chain of monoclonal antibody J591 (designated SEQ. ID. No. 9), the nucleotide sequence of the corresponding reverse, non-coding strand (designated SEQ. ID. No. 10), and the corresponding deduced amino acid sequence (designated SEQ. ID. Nos. 11, 12, and 13).
  • FIG. 11 is a comparison of the kappa light chain of monoclonal antibody J591 with the consensus sequence for Mouse Kappa Chains Subgroup V.
  • One aspect of the present invention relates to a method of ablating or killing normal, benign hyperplastic, and cancerous prostate epithelial cells.
  • the process involves providing a biological agent, such as an antibody or binding portion thereof, probe, or ligand, which binds to an extracellular domain of prostate specific membrane antigen of (i.e., a portion of prostate specific membrane antigen which is external to) such cells.
  • the biological agent can be used alone or can be bound to a substance effective to kill the cells upon binding of the biological agent to the cells.
  • These biological agents are then contacted with the cells under conditions effective to permit both binding of the biological agent to the extracellular domain of the prostate specific membrane antigen and killing or ablating of the cells.
  • such contacting is carried out in a living mammal by administering the biological agent to the mammal under conditions effective to permit both binding of the biological agent to the extracellular domain of the prostate specific membrane antigen and killing or ablating of the cells.
  • Such administration can be carried out orally or parenterally.
  • the biological agent binds to and is internalized with the prostate specific membrane antigen of such cells.
  • the biological agent can be used alone.
  • the biological agent can be bound to a substance effective to kill the cells upon binding of the biological agent to prostate specific membrane antigen and upon internalization of the biological agent with the prostate specific membrane antigen.
  • the biological agent can induce internalization of the prostate specific membrane antigen.
  • internalization of the biological agent can be the result of routine internalization of prostate specific membrane antigen.
  • Another aspect of the present invention relates to a method of detecting normal, benign hyperplastic, and cancerous epithelial cells or portions thereof in a biological sample.
  • This method involves providing a biological agent, such as an antibody or binding portion thereof, probe, or ligand, which binds to an extracellular domain of prostate specific membrane antigen of such cells.
  • the biological agent is bound to a label effective to permit detection of the cells or portions (e.g., prostate specific membrane antigen or fragments thereof liberated from such normal, benign hyperplastic, and cancerous cells) thereof upon binding of the biological agent to the cells or portions thereof.
  • the biological sample is contacted with the biological agent having a label under conditions effective to permit binding of the biological agent to the extracellular domain of the prostate specific membrane antigen of any of the cells or portions thereof in the biological sample.
  • the presence of any cells or portions thereof in the biological sample is detected by detection of the label.
  • such contacting is carried out in a living mammal and involves administering the biological agent to the mammal under conditions effective to permit binding of the biological agent to the prostate specific membrane antigen of any of the cells or portions thereof in the biological sample. Again, such administration can be carried out orally or parenterally.
  • the method of the present invention can be used to screen patients for diseases associated with the presence of normal, benign hyperplastic, and cancerous epithelial cells or portions thereof. Alternatively, it can be used to identify the recurrence of such diseases, particularly when the disease is localized in a particular biological material of the patient. For example, recurrence of prostatic disease in the prostatic fossa may be encountered following radical prostatectomy. Using the method of the present invention, this recurrence can be detected by administering a short range radiolabeled antibody to the mammal and then detecting the label rectally, such as with a transrectal detector probe.
  • the contacting step can be carried out in a sample of serum or urine or other body fluids, such as to detect the presence of PSMA in the body fluid.
  • the biological agent recognize substantially no antigens circulating in the blood other than PSMA. Since intact prostate cells do not excrete or secrete PSMA into the extracellular environment, detecting PSMA in serum, urine, or other body fluids generally indicates that prostate cells are being lysed.
  • the biological agents and methods of the present invention can be used to determine the effectiveness of a prostate cancer treatment protocol by monitoring the level of PSMA in serum, urine or other body fluids.
  • the biological agent such as the antibody or binding portion thereof, probe, or ligand, binds to and is internalized with the prostate specific membrane antigen of such cells.
  • the biological agent is bound to a label effective to permit detection of the cells or portions thereof upon binding of the biological agent to and internalization of the biological agent with the prostate specific membrane antigen.
  • biological agents suitable for either killing, ablating, or detecting normal, benign hyperplastic, and cancerous prostate epithelial cells include antibodies, such as monoclonal or polyclonal antibodies.
  • antibody fragments, half-antibodies, hybrid derivatives, probes, and other molecular constructs may be utilized.
  • These biological agents such as antibodies, binding portions thereof, probes, or ligands, bind to extracellular domains of prostate specific membrane antigens or portions thereof in normal, benign hyperplastic, and cancerous prostate epithelial cells. As a result, the biological agents bind to all such cells, not only to cells which are fixed or cells whose intracellular antigenic domains are otherwise exposed to the extracellular environment.
  • these biological agents such as antibodies, binding portions thereof, probes, or ligands, bind to and are internalized with prostate specific membrane antigens or portions thereof in normal, benign hyperplastic, and cancerous prostate epithelial cells.
  • Monoclonal antibody production may be effected by techniques which are well-known in the art. Basically, the process involves first obtaining immune cells (lymphocytes) from the spleen of a mammal (e.g., mouse) which has been previously immunized with the antigen of interest either in vivo or in vitro. The antibody-secreting lymphocytes are then fused with (mouse) myeloma cells or transformed cells, which are capable of replicating indefinitely in cell culture, thereby producing an immortal, immunoglobulin-secreting cell line. The resulting fused cells, or hybridomas, are cultured, and the resulting colonies screened for the production of the desired monoclonal antibodies.
  • lymphocytes immune cells
  • mammal e.g., mouse
  • myeloma cells or transformed cells which are capable of replicating indefinitely in cell culture, thereby producing an immortal, immunoglobulin-secreting cell line.
  • the resulting fused cells, or hybridomas are cultured, and
  • Colonies producing such antibodies are cloned, and grown either in vivo or in vitro to produce large quantities of antibody.
  • a description of the theoretical basis and practical methodology of fusing such cells is set forth in Kohler and Milstein, Nature 256:495 (1975), which is hereby incorporated by reference.
  • Mammalian lymphocytes are immunized by in vivo immunization of the animal (e.g., a mouse) with the protein or polypeptide of the present invention. Such immunizations are repeated as necessary at intervals of up to several weeks to obtain a sufficient titer of antibodies. Following the last antigen boost, the animals are sacrificed and spleen cells removed.
  • Fusion with mammalian myeloma cells or other fusion partners capable of replicating indefinitely in cell culture is effected by standard and well-known techniques, for example, by using polyethylene glycol (“PEG”) or other fusing agents (See Milstein and Kohler, Eur. J. Immunol. 6:511 (1976), which is hereby incorporated by reference).
  • PEG polyethylene glycol
  • This immortal cell line which is preferably murine, but may also be derived from cells of other mammalian species, including but not limited to rats and humans, is selected to be deficient in enzymes necessary for the utilization of certain nutrients, to be capable of rapid growth, and to have good fusion capability. Many such cell lines are known to those skilled in the art, and others are regularly described.
  • Procedures for raising polyclonal antibodies are also well known. Typically, such antibodies can be raised by administering the protein or polypeptide of the present invention subcutaneously to New Zealand white rabbits which have first been bled to obtain pre-immune serum.
  • the antigens can be injected at a total volume of 100 Al per site at six different sites.
  • Each injected material will contain synthetic surfactant adjuvant pluronic polyols, or pulverized acrylamide gel containing the protein or polypeptide after SDS-polyacrylamide gel electrophoresis.
  • the rabbits are then bled two weeks after the first injection and periodically boosted with the same antigen three times every six weeks. A sample of serum is then collected 10 days after each boost.
  • Polyclonal antibodies are then recovered from the serum by affinity chromatography using the corresponding antigen to capture the antibody. Ultimately, the rabbits are euthenized with pentobarbital 150 mg/Kg IV. This and other procedures for raising polyclonal antibodies are disclosed in E. Harlow, et. al., editors, Antibodies: A Laboratory Manual (1988), which is hereby incorporated by reference.
  • binding portions of such antibodies include Fab fragments, F(ab′) 2 fragments, and Fv fragments.
  • Fab fragments include Fab fragments, F(ab′) 2 fragments, and Fv fragments.
  • F(ab′) 2 fragments include Fab fragments, F(ab′) 2 fragments, and Fv fragments.
  • These antibody fragments can be made by conventional procedures, such as proteolytic fragmentation procedures, as described in J. Goding, Monoclonal Antibodies: Principles and Practice , pp. 98-118 (N.Y. Academic Press 1983), which is hereby incorporated by reference.
  • the processes of the present invention can utilize probes or ligands found either in nature or prepared synthetically by recombinant DNA procedures or other biological or molecular procedures.
  • Suitable probes or ligands are molecules which bind to the extracellular domains of prostate specific membrane antigens identified by the monoclonal antibodies of the present invention.
  • Other suitable probes or ligands are molecules which bind to and are internalized with prostate specific membrane antigens.
  • Such probes or ligands can be, for example, proteins, peptides, lectins, or nucleic acid probes.
  • These antibodies can be used alone or as a component in a mixture with other antibodies or other biological agents to treat or image prostate epithelial cells with varying surface antigen characteristics.
  • the biological agents can be administered orally, parenterally, subcutaneously, intravenously, intramuscularly, intraperitoneally, by intranasal instillation, by intracavitary or intravesical instillation, intraocularly, intraarterially, intralesionally, or by application to mucous membranes, such as, that of the nose, throat, and bronchial tubes.
  • They may be administered alone or with pharmaceutically or physiologically acceptable carriers, excipients, or stabilizers, and can be in solid or liquid form such as, tablets, capsules, powders, solutions, suspensions, or emulsions.
  • the solid unit dosage forms can be of the conventional type.
  • the solid form can be a capsule, such as an ordinary gelatin type containing the biological agent, such as an antibody or binding portion thereof, of the present invention and a carrier, for example, lubricants and inert fillers such as, lactose, sucrose, or cornstarch.
  • these compounds are tableted with conventional tablet bases such as lactose, sucrose, or cornstarch in combination with binders like acacia, cornstarch, or gelatin, disintegrating agents such as, cornstarch, potato starch, or alginic acid, and a lubricant like stearic acid or magnesium stearate.
  • the biological agent of the present invention may also be administered in injectable dosages by solution or suspension of these materials in a physiologically acceptable diluent with a pharmaceutical carrier.
  • a pharmaceutical carrier include sterile liquids such as water and oils, with or without the addition of a surfactant and other pharmaceutically and physiologically acceptable carrier, including adjuvants, excipients or stabilizers.
  • sterile liquids such as water and oils, with or without the addition of a surfactant and other pharmaceutically and physiologically acceptable carrier, including adjuvants, excipients or stabilizers.
  • Illustrative oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, or mineral oil.
  • water, saline, aqueous dextrose and related sugar solution, and glycols such as, propylene glycol or polyethylene glycol, are preferred liquid carriers, particularly for injectable solutions.
  • the biological agent of the present invention in solution or suspension may be packaged in a pressurized aerosol container together with suitable propellants, for example, hydrocarbon propellants like propane, butane, or isobutane with conventional adjuvants.
  • suitable propellants for example, hydrocarbon propellants like propane, butane, or isobutane with conventional adjuvants.
  • the materials of the present invention also may be administered in a non-pressurized form such as in a nebulizer or atomizer.
  • the biological agents may be utilized to detect normal, benign hyperplastic, and cancerous prostate epithelial cells in vivo. This is achieved by labeling the biological agent, administering the labeled biological agent to a mammal, and then imaging the mammal.
  • radiolabels such as 131 I, 111 In, 123 I, 99m Tc, 32 P, 125 I, 3 H, 14 C, and 188 Rh
  • fluorescent labels such as fluorescein and rhodamine
  • nuclear magnetic resonance active labels such as positron emitting isotopes detectable by a positron emission tomography (“PET”) scanner
  • chemiluminescers such as luciferin
  • enzymatic markers such as peroxidase or phosphatase.
  • Short-range radiation emitters such as isotopes detectable by short-range detector probes, such as a transrectal probe, can also be employed.
  • isotopes and transrectal detector probes when used in combination, are especially useful in detecting prostatic fossa recurrences and pelvic nodal disease.
  • the biological agent can be labeled with such reagents using techniques known in the art. For example, see Wensel and Meares, Radioimmunoimaging and Radioimmunotherapy, Elsevier, N.Y. (1983), which is hereby incorporated by reference, for techniques relating to the radiolabeling of antibodies. See also, D. Colcher et al., “Use of Monoclonal Antibodies as Radiopharmaceuticals for the Localization of Human Carcinoma Xenografts in Athymic Mice”, Meth. Enzymol. 121: 802-816 (1986), which is hereby incorporated by reference.
  • a radiolabeled biological agent of this invention can be used for in vitro diagnostic tests.
  • the specific activity of a tagged biological agent depends upon the half-life, the isotopic purity of the radioactive label, and how the label is incorporated into the biological agent.
  • Table 2 lists several commonly-used isotopes, their specific activities and half-lives. In immunoassay tests, the higher the specific activity, in general, the better the sensitivity.
  • Radiolabeling elements which are useful in imaging include 123 I, 131 I, 111 In, and 99m Tc, for example.
  • Procedures for iodinating biological agents are described by Greenwood, F. et al., Biochem. J. 89:114-123 (1963); Marchalonis, J., Biochem. J.
  • the biological agent is administered to the patient, is localized to the tumor bearing the antigen with which the biological agent reacts, and is detected or “imaged” in vivo using known techniques such as radionuclear scanning using e.g., a gamma camera or emission tomography. See e.g., A. R. Bradwell et al., “Developments in Antibody Imaging”, Monoclonal Antibodies for Cancer Detection and Therapy, R. W. Baldwin et al., (eds.), pp. 65-85 (Academic Press 1985), which is hereby incorporated by reference.
  • a positron emission transaxial tomography scanner such as designated Pet VI located at Brookhaven National Laboratory, can be used where the radiolabel emits positrons (e.g., 11 C, 18 F, 15 O, and 13 N)
  • Fluorophore and chromophore labeled biological agents can be prepared from standard moieties known in the art. Since antibodies and other proteins absorb light having wavelengths up to about 310 nm, the fluorescent moieties should be selected to have substantial absorption at wavelengths above 310 nm and preferably above 400 nm. A variety of suitable fluorescers and chromophores are described by Stryer, Science, 162:526 (1968) and Brand, L. et al., Annual Review of Biochemistry, 41:843-868 (1972), which are hereby incorporated by reference. The biological agents can be labeled with fluorescent chromophore groups by conventional procedures such as those disclosed in U.S. Pat. Nos. 3,940,475, 4,289,747, and 4,376,110, which are hereby incorporated by reference.
  • fluorescers having a number of the desirable properties described above are the xanthene dyes, which include the fluoresceins derived from 3,6-dihydroxy-9-henylxanthhydrol and resamines and rhodamines derived from 3,6-diamino-9-phenylxanthydrol and lissanime rhodamine B.
  • the rhodamine and fluorescein derivatives of 9-o-carboxyphenylxanthhydrol have a 9-o-carboxyphenyl group.
  • Fluorescein compounds having reactive coupling groups such as amino and isothiocyanate groups such as fluorescein isothiocyanate and fluorescamine are readily available.
  • Another group of fluorescent compounds are the naphthylamines, having an amino group in the ⁇ or ⁇ position.
  • Bio agents can be labeled with fluorchromes or chromophores by the procedures described by Goding, J. (supra, pp 208-249).
  • the biological agents can be labeled with an indicating group containing the NMR-active 19 F atom, or a plurality of such atoms inasmuch as (i) substantially all of naturally abundant fluorine atoms are the 19 F isotope and, thus, substantially all fluorine-containing compounds are NMR-active; (ii) many chemically active polyfluorinated compounds such as trifluoracetic anhydride are commercially available at relatively low cost, and (iii) many fluorinated compounds have been found medically acceptable for use in humans such as the perfluorinated polyethers utilized to carry oxygen as hemoglobin replacements.
  • the antibodies of the present invention (or other biological agents of the present invention), labeled as described above, can be coadministered along with an antibody or other biological agent which recognizes only living or only dead prostate epithelial cells labeled with a label which can be distinguished from the label used to label the subject antibody.
  • an antibody or other biological agent which recognizes only living or only dead prostate epithelial cells labeled with a label which can be distinguished from the label used to label the subject antibody.
  • concentration of the two labels at various locations or times, spatial and temporal concentration variations of living and dead normal, benign hyperplastic, and cancerous prostate epithelial cells can be ascertained.
  • this method can be carried out using the labeled antibodies of the present invention, which recognize both living and dead epithelial prostate cells, and labeled 7E11 antibodies, which recognize only dead epithelial prostate cells.
  • the biological agents can also be utilized to kill or ablate normal, benign hyperplastic, and cancerous prostate epithelial cells in vivo. This involves using the biological agents by themselves or with a cytotoxic drug to which the biological agents recognizing normal, benign hyperplastic, and cancerous prostate epithelial cells are bound. This involves administering the biological agents bonded to a cytotoxic drug to a mammal requiring such treatment. Since the biological agents recognize prostate epithelial cells, any such cells to which the biological agents bind are destroyed. Although such administration may destroy normal prostate epithelial cells, this is not problematic, because the prostate is not required for life or survival. Although the prostate may indirectly contribute to fertility, this is not likely to be a practical consideration in patients receiving the treatment of the present invention.
  • the biological agents of the present invention may be used to deliver a variety of cytotoxic drugs including therapeutic drugs, a compound emitting radiation, molecules of plants, fungal, or bacterial origin, biological proteins, and mixtures thereof.
  • the cytotoxic drugs can be intracellularly acting cytotoxic drugs, such as short-range radiation emitters, including, for example, short-range, high-energy ⁇ -emitters.
  • Enzymatically active toxins and fragments thereof are exemplified by diphtheria toxin A fragment, nonbinding active fragments of diphtheria toxin, exotoxin A (from Pseudomonas aeruginosa ), ricin A chain, abrin A chain, modeccin A chain, ⁇ -sacrin, certain Aleurites fordii proteins, certain Dianthin proteins, Phytolacca americana proteins (PAP, PAPII and PAP-S), Morodica charantia inhibitor, curcin, crotin, Saponaria officinalis inhibitor, gelonin, mitogillin, restrictocin, phenomycin, and enomycin, for example.
  • cytotoxic moieties are derived from adriamycin, chlorambucil, daunomycin, methotrexate, neocarzinostatin, and platinum, for example.
  • a first biological agent is conjugated with a prodrug which is activated only when in close proximity with a prodrug activator.
  • the prodrug activator is conjugated with a second biological agent according to the present invention, preferably one which binds to a non-competing site on the prostate specific membrane antigen molecule.
  • a second biological agent preferably one which binds to a non-competing site on the prostate specific membrane antigen molecule.
  • Monoclonal antibody J415 binds to a binding site which is non-competing with the site to which J591, J533, and E99 bind.
  • the first biological agent can be one of J591, J533, and E99
  • the second biological agent can be J415.
  • the first biological agent can be J415
  • the second biological agent can be one of J591, J533, and E99.
  • Drug-prodrug pairs suitable for use in the practice of the present invention are described in Blakely et al., “ZD2767, an Improved System for Antibody-directed Enzyme Prodrug Therapy That Results in Tumor Regressions in Colorectal Tumor Xenografts,” Cancer Research, 56:3287-3292 (1996), which is hereby incorporated by reference.
  • the biological agent can be coupled to high energy radiation emitters, for example, a radioisotope, such as 131 I, a ⁇ -emitter, which, when localized at the tumor site, results in a killing of several cell diameters.
  • a radioisotope such as 131 I
  • a ⁇ -emitter which, when localized at the tumor site, results in a killing of several cell diameters.
  • radioisotopes include ⁇ -emitters, such as 212 Bi, 213 Bi, and 211 At, and ⁇ -emitters, such as 186 Re and 90 Y. Radiotherapy is expected to be particularly effective, because prostate cancer is a relatively radiosensitive tumor.
  • the biological agents are used alone to kill or ablate prostate epithelial cells, such killing or ablation can be effected by initiating endogenous host immune functions, such as complement-mediated or antibody-dependent cellular cytotoxicity.
  • the biological agent of the present invention can be used and sold together with equipment, as a kit, to detect the particular label.
  • Bio agents of the present invention can be used in conjunction with other therapeutic treatment modalities. Such other treatments include surgery, radiation, cryosurgery, thermotherapy, hormone treatment, chemotherapy, vaccines, and other immunotherapies.
  • Also encompassed by the present invention is a method of killing or ablating which involves using the biological agents for prophylaxis.
  • these materials can be used to prevent or delay development or progression of prostate cancer.
  • the prostate cancer therapy of the present invention has a number of benefits. Since the biological agents according to the present invention only target prostate epithelial cells, other tissue is spared. As a result, treatment with such biological agents is safer, particularly for elderly patients. Treatment according to the present invention is expected to be particularly effective, because it directs high levels of biological agents, such as antibodies or binding portions thereof, probes, or ligands, to the bone marrow and lymph nodes where prostate cancer metastases predominate. Moreover, tumor sites for prostate cancer tend to be small in size and, therefore, easily destroyed by cytotoxic agents.
  • biological agents such as antibodies or binding portions thereof, probes, or ligands
  • Treatment in accordance with the present invention can be effectively monitored with clinical parameters such as serum prostate specific antigen and/or pathological features of a patient's cancer, including stage, Gleason score, extracapsular, seminal, vesicle or perineural invasion, positive margins, involved lymph nodes, etc.
  • clinical parameters such as serum prostate specific antigen and/or pathological features of a patient's cancer, including stage, Gleason score, extracapsular, seminal, vesicle or perineural invasion, positive margins, involved lymph nodes, etc.
  • these parameters can be used to indicate when such treatment should be employed.
  • the biological agents of the present invention bind to living prostate cells, therapeutic methods using these biological agents are much more effective than those which target lysed prostate cells. For the same reasons, diagnostic and imaging methods which determine the location of living normal, benign hyperplastic, or cancerous prostate epithelial cells are much improved by employing the biological agents of the present invention. In addition, the ability to differentiate between living and dead prostate cells can be advantageous, especially to monitor the effectiveness of a particular treatment regimen.
  • Hybridomas E99, J415, J533, and J591 have been deposited pursuant to, and in satisfaction of, the requirements of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure with the American Type Culture Collection (“A.T.C.C.”) at 12301 Parklawn Drive, Rockville, Md. 20852.
  • Hybridoma E99 was deposited on May 2, 1996, and received A.T.C.C. Designation Number HB-12101.
  • Hybridoma J415 was deposited on May 30, 1996, and received A.T.C.C. Designation Number HB-12109.
  • Hybridomas J533 and J591 were deposited on Jun. 6, 1996, and received A.T.C.C. Designation Numbers HB-12127 and HB-12126, respectively.
  • LNCaP Horoszewicz, J. S., et al., “LNCaP Model Of Human Prostatic Carcinoma,” Cancer Res., 43:1809-1818 (1983), which is hereby incorporated by reference
  • Hybridomas were initially cloned in RPMI-1640 medium supplemented with 10% FCS, 0.1 mM nonessential amino acids, 2 mM L-glutamine, 100 units/ml of penicillin, 100 ug/ml of streptomycin and HAT medium (GIBCO, Grand Island, N.Y.). Subclones were cultured in the same medium without aminopterin.
  • mice Female BALB/c mice were immunized intraperitoneally with LNCaP (6 ⁇ 10 6 cells) three times at 2 week intervals. A final intraperitoneal booster immunization was administered with fresh prostate epithelial cells which had been grown in vitro. Three days later, spleen cells were fused with SP-2 mouse myeloma cells utilizing standard techniques (Ueda, R., et al., “Cell Surface Antigens Of Human Renal Cancer Defined By Mouse Monoclonal Antibodies: Identification Of Tissue-Specific Kidney Glycoproteins,” Proc. Natl. Acad. Sci. USA, 78:5122-5126 (1981), which is hereby incorporated by reference).
  • mAbs were dialyzed in 0.1 M NaHCO 3 for 2 hours.
  • One ml of mAb at 1 mg/ml was mixed with 0.1 ml of biotinamidocaproate N-hydroxysuccinamide ester (Sigma) in dimethylsulfoxide (1 mg/ml) and stirred for 4 hours at room temperature. Unbound biotin was removed by dialysis against phosphate buffered saline (“PBS”).
  • PBS phosphate buffered saline
  • Cryostat sections of prostate tissues were placed inside rings of Falcon 3034 plate covers (Becton-Dickenson, Lincoln Park, N.J.) previously coated with 0.45% gelatin solution as described in Marusich, M. F., “A Rapid Method For Processing Very Large Numbers Of Tissue Sections For Immunohistochemical Hybridoma Screening,” J. Immunol. Methods, 111:143-145 (1988), which is hereby incorporated by reference. Plates were stored at ⁇ 80° C. Cryostat sections were fixed with 2% paraformaldehyde in PBS for 10 min at room temperature, and, after washing with PBS, endogenous peroxidase activity was blocked by treatment with 0.3% hydrogen peroxide in PBS for 10 min at room temperature.
  • the anti-mouse immunoglobulin mixed hemadsorption assay was performed as described in Ueda, R., et al., “Cell Surface Antigens Of Human Renal Cancer Defined By Mouse Monoclonal Antibodies: Identification Of Tissue-Specific Kidney Glycoproteins,” Proc. Natl. Acad. Sci. USA, 78:5122-5126 (1981), which is hereby incorporated by reference.
  • To prepare the indicator cells anti-mouse Ig (DAKO Corp.) was conjugated to type O human RBC using 0.01% chromium chloride.
  • Serological assays were performed on cells previously plated in Terasaki plates (Nunc, Denmark). Antibodies were incubated with target cells at room temperature for 1 hour. Target cells were then washed, and indicator cells added for 1 hour.
  • LNCaP cells (2 ⁇ 10 7 ) were biotinylated with biotin-NHSS (at final concentration of 5 mM) for 30 minutes on ice. After washing, the biotinylated cells were resuspended in 1 ml lysis buffer (20 mM Tris/HCl pH 8.0, 1 mM EDTA, 1 mM PMSF, 1% triton X-100) for 30 min on ice. The suspension was centrifuged at 1500 g ⁇ 100 min at 4° C., and the supernatant was centrifuged at 12,000 rpm ⁇ 15 min at 4° C.
  • 1 ml lysis buffer (20 mM Tris/HCl pH 8.0, 1 mM EDTA, 1 mM PMSF, 1% triton X-100
  • the resulting lysate was preabsorbed with rabbit or goat anti-mouse IgG-coated pansorbin for 1 hour at 4° C.
  • the pre-absorbed lysate was incubated with the mAb overnight at 4° C.
  • Rabbit or goat anti-mouse Ig-coated agarose beads were added for 2 hours at 4° C. and then washed.
  • the beads were resuspended in Tris-base/NaCl, added to sample buffer with 2-mercaptoethanol, and boiled for 5 min. After centrifuging, the supernatant was run on an SDS-PAGE 12% gel. The gel was transferred to a nitrocellulose membrane which was blocked and stained with straptavidin-peroxidase.
  • the membrane was developed with diaminobenzidine (“DAB”).
  • DAB diaminobenzidine
  • Sequential immunoprecipitation was similar except that the lysate was initially pre-cleared with one mAb overnight at 4° C. A second mAb was then used to immunoprecipitate the pre-cleared lysate.
  • the membranes were incubated with sheep anti-mouse-Ig-peroxidase ⁇ fraction (1/5000) ⁇ in 5% dry milk/TBST for 60 min at room temperature. After repeat washing, the membranes were developed using a chemiluminescent tag designated “ECL” (Amersham Life Sciences, International, Arlington Heights, Ill.) according to the manufacturer's directions. The results of the Western Blot experiment are presented in Table 4.
  • LNCaP cells were tested, without fixation, in vitro, by immunofluorescence.
  • LNCaP cells were washed and incubated with mAb for 1 hour at room temperature and then with a rabbit anti-mouse Ig-fluorescein (DAKO Corp., Santa Barbara, Calif.). Wells were read with a fluorescent microscope.
  • Negative control consisted of an isotype-matched irrelevant mAb, while an anti-class I MHC mAb served as a positive control.
  • Plates were coated with LNCaP cell line lysate as a source of prostate specific membrane antigen and washed to remove unbound material. “Cold” (unlabeled) monoclonal antibody was incubated on the plate for 1 hour at room temperature to allow binding to its antigenic site. Subsequently, a second monoclonal antibody, labeled either with biotin or 125 I, was added for an additional hour. Plates were washed to remove unbound material.
  • the amount of the second monoclonal antibody bound to the prostate specific membrane antigen-coated plate was determined either by avidin-alkaline phosphatase in an enzyme-linked immunoassay (in the case of biotin-labeled second monoclonal antibody) or by physically counting the well in a gamma counter (in the case of 125 I-labeled second monoclonal antibody). Controls consisted of using the same monoclonal antibody both cold and labeled to define “100% competition” or using monoclonal antibody to a totally different molecule (e.g., monoclonal antibody I-56, which detects inhibin, a prostate related protein different from prostate specific membrane antigen) to define “0% competition”.
  • monoclonal antibody I-56 which detects inhibin, a prostate related protein different from prostate specific membrane antigen
  • Having pairs of monoclonal antibodies which bind to non-competing sites permits development of antibody sandwich assays for detecting soluble antigens, such as solubilized prostate specific membrane antigen or fragment thereof, in, for example, body fluids.
  • the antigen e.g., prostate specific membrane antigen or a fragment thereof
  • the antigen could be “captured” from body fluid with J591 and, in another step, detected by labeled J415.
  • monoclonal antibody J591 can be conjugated with an inactive pro-drug and J415 can be conjugated with a pro-drug activator. Since prodrug and activator would be bound in close proximity only at the site of prostate specific membrane antigen-expressing cells (e.g., prostate cancer cells), prodrug activation to the active form would occur only at those sites.
  • prostate specific membrane antigen-expressing cells e.g., prostate cancer cells
  • FIGS. 1 - 4 are immuno-electron micrographs which follow the interaction of gold-labeled monoclonal antibody J591 with the cell surface as a function of time. In these figures, the location of the monoclonal antibody is indicated by the black dots.
  • FIG. 1 shows the cell prior to 37° C. incubation. J591 can be seen bound to the cell along the external aspect of the cell membrane.
  • M denotes the cell's mitochondria
  • N denotes its nucleus.
  • FIG. 2 shows the cell after incubation at 37° C. for 5 minutes. The arrow indicates formation of a clathrin-coated pit.
  • FIG. 3 which shows the cell after a 10 minute 37° C.
  • FIG. 4 shows that, after incubation at 37° C. for 15 minutes, monoclonal antibody J591 is contained in endocytic vesicles within the cell, as indicated by the arrows. As can be seen in FIG. 5, after incubation at 37° C. for 15 minutes, monoclonal antibody J591 is also contained within endosomes, as indicated by the arrows.
  • Total RNA was prepared from 10 7 murine hybridoma J591 cells. A sample of the conditioned medium from these cells was tested for binding to the specific antigen for J591 on prostate cells. The conditioned medium was positive by both ELISA and Western Blot for binding to the antigen.
  • VH and VK cDNA were prepared using reverse transcriptase and mouse ⁇ constant region and mouse IgG constant region primers.
  • the first strand cDNAs were amplified by PCR using a variety of mouse signal sequence primers (6 for VH and 7 for VK).
  • the amplified DNAs were gel-purified and cloned into the vector pT7Blue.
  • VH and VK clones obtained were screened for correct inserts by PCR, and the DNA sequence of selected clones was determined by the dideoxy chain termination method.
  • the corresponding deduced amino acid sequences of J591 VH designated SEQ. ID. No. 3, SEQ. ID. No. 4, and SEQ. ID. No. 5, are also shown in FIG. 7.
  • the coding strand of the J591 heavy chain's variable region (exclusive of signal sequence and constant region components) has the following nucleotide sequence (designated SEQ. ID. No.
  • the reverse, non-coding strand of the J591 heavy chain's variable region has the following nucleotide sequence (designated SEQ. ID. No. 7): TGAGGAGACTGTGAGAGTGGTGCCTTGGCCCCAGTAGTCAAAGTTCCAACCAGCTGC ACAATAATAGACTGCAGAATCCTCAGATGTTAGGCTGCGGAGCTCCATGTAGGCTGT ACTGGAGGACTTGTCTACAGTCAATGTGGCCTTGTCCTCGAACTTCTGATTGTAGGT GGTACCACCATTGTTAGGATTGATGTTTCCAATCCACTCAAGGCTCTTTCCATGGCT CTGCTTCACCCAGTGTATGGTATATTCAGTGAATGTGTATCCAGAAGTCTTGCAGGA TATCCTCACTGAAGTCCCAGGCTTCACCAGTTCAGGTCCAGACTGTTGCAGGA TATCCTCACTGAAGTCCCAGGCTTCACCAGTTCAGGTCCAGACTGTTGCAGGA TATCCTCACTGAAGTCCCAGGCTTCACCAGTTCAGTTC
  • the protein sequence corresponding to the J591 heavy chain's variable region has the following nucleotide sequence (designated SEQ. ID. No. 8): EVQLQQSGPELVKPGTSVRISCKTSGYTFTEYTIHWVKQSHGKSLEWIGNINPNNGG TTYNQKFEDKATLTVDKSSSTAYMELRSLTSEDSAVYYCAAGWNFDYWGQGTTLTVS SEQ. ID. No. 8
  • the J591 VH is in Mouse Heavy Chains Subgroup IIA (Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services (1991) (“Kabat”), which is hereby incorporated by reference).
  • the sequence of J591 VH is compared to the consensus sequence for this subgroup in FIG. 8.
  • the nucleic acid sequence of J591 VK corresponding to the ten identical clones (designated SEQ. ID. No. 9) is presented in FIG. 10, along with the nucleic acid sequence of the corresponding reverse, non-coding strand (designated SEQ. ID. No. 10) and the deduced amino acid sequences, which are designated SEQ. ID. No. 11, SEQ. ID. No. 12, and SEQ. ID. No. 13. These sequences include part of the signal sequence and part of the constant region of the antibody.
  • the coding strand of the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to the ten identical clones has the following nucleotide sequence (designated SEQ. ID. No.
  • the reverse, non-coding strand of the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to the ten identical clones has the following nucleotide sequence (designated SEQ. ID. No.
  • the protein sequence corresponding to the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to the ten identical clones has the following nucleotide sequence (designated SEQ. ID. No. 16): NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTG VPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIK
  • the coding strand of the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to clone VK17 has the following nucleotide sequence (designated SEQ. ID. No.
  • the reverse, non-coding strand of the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to clone VK17 has the following nucleotide sequence (designated SEQ. ID. No.
  • the protein sequence corresponding to the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to clone VK17 has the following nucleotide sequence (designated SEQ. ID. No. 19): DIVMTQSHKFMSTSVGDRVSIICKASQDVGTAVDWYQQKPGQSPKLLIYWASTRHTG VPDRFTGSGSGTDFTLTITNVQSEDLADYFCQQYNSYPLTFGAGTMLDLK
  • J591 VK is in the Mouse Kappa Chains Subgroup V (Kabat, which is hereby incorporated by reference). The sequence of J591 VK corresponding to the ten identical clones is compared to the consensus sequence for the subgroup in FIG. 11.

Abstract

The present invention is directed to the use of antibodies or binding portions thereof, probes, ligands, or other biological agents which either recognize an extracellular domain of prostate specific membrane antigen or bind to and are internalized with prostate specific membrane antigen. These biological agents can be labeled and used for detection of normal, benign hyperplastic, and cancerous prostate epithelial cells or portions thereof. They also can be used alone or bound to a substance effective to ablate or kill such cells as a therapy for prostate cancer. Also disclosed are four hybridoma cell lines, each of which produces a monoclonal antibody recognizing extracellular domains of prostate specific membrane antigens of normal, benign hyperplastic, and cancerous prostate epithelial cells or portions thereof.

Description

  • The present application claims the benefit of U.S. Provisional Patent Application Serial No. 60/016,976, filed May 6, 1996, and U.S. Provisional Patent Application Serial No. 60/022,125, filed Jul. 18, 1996.[0001]
  • FIELD OF THE INVENTION
  • The present invention relates to the treatment and diagnosis of prostate cancer with biological agents. [0002]
  • BACKGROUND OF THE INVENTION
  • Prostate cancer is the most common cancer in men with an estimated 317,000 cases in 1996 in the United States. It is the second leading cause of death among men who die from neoplasia with an estimated 40,000 deaths per year. Prompt detection and treatment is needed to limit mortality caused by prostate cancer. [0003]
  • Detection of Prostate Cancer [0004]
  • When it metastasizes, prostatic cancer has a distinct predilection for bone and lymph nodes. Saitoh et al., “Metastatic Patterns of Prostatic Cancer. Correlation Between Sites And Number Of Organs Involved,” [0005] Cancer, 54:3078-3084 (1984). At the time of clinical diagnosis, as many as 25% of patients have bone metastasis demonstrable by radionuclide scans. Murphy, G. P., et al., “The National Survey Of Prostate Cancer In The United States By The American College Of Surgeons,” J. Urol., 127:928-939 (1982). Accurate clinical evaluation of nodal involvement has proven to be difficult. Imaging techniques such as computed tomography (“CT”) or magnetic resonance (“MR”) imaging are unable to distinguish metastatic prostate cancer involvement of lymph nodes by criterion other than size (i.e., >1 cm). Therefore, by definition, these imaging modalities are inherently insensitive in the detection of small volume (<1 cm) disease as well as non-specific in the detection of larger volume adenopathy. A recent study assessed the accuracy of MR in patients with clinically localized prostate cancer. Rifkin et al., “Comparison Of Magnetic Resonance Imaging And Ultrasonography In Staging Early Prostate Cancer,” N. Engel. J. Med., 323:621-626 (1990). In this study, 194 patients underwent an MR and 185 of these patients had a lymph node dissection. 23 (13%) patients had pathologically involved lymph nodes. MR was suspicious in only 1 of these 23 cases resulting in a sensitivity of 4%. Similar results have also been noted with CT scans. Gasser et al., “MRI And Ultrasonography In Staging Prostate Cancer,” N. Engl. J. Med. (Correspondence), 324 (7): 49-495 (1991).
  • The elevation of serum acid phosphatase activity in patients having metastasized prostate carcinoma was first reported by Gutman et al., [0006] J. Clin. Invest 17:473 (1938). In cancer of the prostate, prostatic acid phosphatase is released from the cancer tissue into the blood stream with the result that the total serum acid phosphatase level can be greatly increased above normal values. Numerous studies of this enzyme and its relation to prostatic cancer have been made since that time, e.g. Yam, Amer. J. Med. 56:604 (1974). However, the measurement of serum acid phosphatase is elevated in about 65-90 percent of patients having carcinoma of the prostate with bone metastasis; in about 30 percent of patients without roentgenological evidence of bone metastasis; and in about only 5-10 percent of patients lacking clinically demonstrable metastasis.
  • Prior art attempts to develop a specific test for prostatic acid phosphatase have met with only limited success, because techniques which rely on enzyme activity on a so-called “specific” substrate cannot take into account other biochemical and immunochemical differences among the many acid phosphatases which are unrelated to enzyme activity of prostate origin. In the case of isoenzymes, i.e. genetically defined enzymes having the same characteristic enzyme activity and a similar molecular structure but differing in amino acid sequences and/or content and, therefore, immunochemically distinguishable, it would appear inherently impossible to distinguish different isoenzyme forms merely by the choice of a particular substrate. It is, therefore, not surprising that none of these prior art methods is highly specific for the direct determination of prostatic acid phosphatase activity; e.g. see [0007] Cancer 5:236 (1952); J. Lab. Clin. Med. 82:486 (1973); Clin. Chem. Acta. 44:21 (1973); and J. Physiol. Chem. 356:1775 (1975).
  • In addition to the aforementioned problems of non-specificity which appear to be inherent in many of the prior art reagents employed for the detection of prostate acid phosphatase, there have been reports of elevated serum acid phosphatase associated with other diseases, which further complicates the problem of obtaining an accurate clinical diagnosis of prostatic cancer. For example, Tuchman et al., [0008] Am. J. Med. 27:959 (1959) noted that serum acid phosphatase levels appear to be elevated in patients with Gaucher's disease.
  • Due to the inherent difficulties in developing a “specific” substrate for prostate acid phosphatase, several researchers have developed immunochemical methods for the detection of prostate acid phosphatase. However, the previously reported immunochemical methods have drawbacks of their own which have precluded their widespread acceptance. For example, Shulman et al., [0009] Immunology 93:474 (1964) described an immuno-diffusion test for the detection of human prostate acid phosphatase. Using antisera prepared from a prostatic fluid antigen obtained by rectal massage from patients with prostatic disease, no cross-reactivity precipitin line was observed in the double diffusion technique against extracts of normal kidney, testicle, liver, and lung. However, this method has the disadvantages of limited sensitivity, even with the large amounts of antigen employed, and of employing antisera which may cross-react with other, antigenically unrelated serum protein components present in prostatic fluid.
  • WO 79/00475 to Chu et. al. describes a method for the detection of prostatic acid phosphatase isoenzyme patterns associated with prostatic cancer which obviates many of the above drawbacks. However, practical problems are posed by the need for a source of cancerous prostate tissue from which the diagnostically relevant prostatic acid phosphatase isoenzyme patterns associated with prostatic cancer are extracted for the preparation of antibodies thereto. [0010]
  • In recent years, considerable effort has been spent to identify enzyme or antigen markers for various types of malignancies with the view towards developing specific diagnostic reagents. The ideal tumor marker would exhibit, among other characteristics, tissue or cell-type specificity. Previous investigators have demonstrated the occurrence of human prostate tissue-specific antigens. [0011]
  • Treatment of Prostate Cancer [0012]
  • As described in W. J. Catalona, “Management of Cancer of the Prostate,” [0013] New Engl. J. Med., 331(15): 996-1004 (1994), the management of prostate cancer can be achieved by watchful waiting, curative treatment, and palliation.
  • For men with a life expectancy of less than 10 years, watchful waiting is appropriate where low-grade, low-stage prostate cancer is discovered at the time of a partial prostatectomy for benign hyperplasia. Such cancers rarely progress during the first five years after detection. On the other hand, for younger men, curative treatment is often more appropriate. [0014]
  • Where prostate cancer is localized and the patient's life expectancy is 10 years or more, radical prostatectomy offers the best chance for eradication of the disease. Historically, the drawback of this procedure is that most cancers had spread beyond the bounds of the operation by the time they were detected. However, the use of prostate-specific antigen testing has permitted early detection of prostate cancer. As a result, surgery is less extensive with fewer complications. Patients with bulky, high-grade tumors are less likely to be successfully treated by radical prostatectomy. [0015]
  • After surgery, if there are detectable serum prostate-specific antigen concentrations, persistent cancer is indicated. In many cases, prostate-specific antigen concentrations can be reduced by radiation treatment. However, this concentration often increases again within two years. [0016]
  • Radiation therapy has also been widely used as an alternative to radical prostatectomy. Patients generally treated by radiation therapy are those who are older and less healthy and those with higher-grade, more clinically advanced tumors. Particularly preferred procedures are external-beam therapy which involves three dimensional, conformal radiation therapy where the field of radiation is designed to conform to the volume of tissue treated; interstitial-radiation therapy where seeds of radioactive compounds are implanted using ultrasound guidance; and a combination of external-beam therapy and interstitial-radiation therapy. [0017]
  • For treatment of patients with locally advanced disease, hormonal therapy before or following radical prostatectomy or radiation therapy has been utilized. Hormonal therapy is the main form of treating men with disseminated prostate cancer. Orchiectomy reduces serum testosterone concentrations, while estrogen treatment is similarly beneficial. Diethylstilbestrol from estrogen is another useful hormonal therapy which has a disadvantage of causing cardiovascular toxicity. When gonadotropin-releasing hormone agonists are administered testosterone concentrations are ultimately reduced. Flutamide and other nonsteroidal, anti-androgen agents block binding of testosterone to its intracellular receptors. As a result, it blocks the effect of testosterone, increasing serum testosterone concentrations and allows patients to remain potent—a significant problem after radical prostatectomy and radiation treatments. [0018]
  • Cytotoxic chemotherapy is largely ineffective in treating prostate cancer. Its toxicity makes such therapy unsuitable for elderly patients. In addition, prostate cancer is relatively resistant to cytotoxic agents. [0019]
  • Use of Monoclonal Antibodies in Prostate Cancer Detection and Treatment [0020]
  • Theoretically, radiolabeled monoclonal antibodies (“mAbs”) offer the potential to enhance both the sensitivity and specificity of detecting prostatic cancer within lymph nodes and elsewhere. While many mAbs have previously been prepared against prostate related antigens, none of these mAbs were specifically generated with an imaging objective in mind. Nevertheless, the clinical need has led to evaluation of some of these mAbs as possible imaging agents. Vihko et al., “Radioimaging of Prostatic Carcinoma With Prostatic Acid Phosphatase—Specific Antibodies,” [0021] Biotechnology in Diagnostics, 131-134 (1985); Babaian et al., “Radioimmunological Imaging of Metastatic Prostatic Cancer With 111-Indium-Labeled Monoclonal Antibody PAY 276,” J. Urol., 137:439-443 (1987); Leroy et al., “Radioimmunodetection Of Lymph Node Invasion In Prostatic Cancer. The Use Of Iodine 123 (123-I)-Labeled Monoclonal Anti-Prostatic Acid Phosphatase (PAP) 227 A F (ab′) 2 Antibody Fragments In Vivo,” Cancer, 64:1-5 (1989); Meyers et al., “Development Of Monoclonal Antibody Imaging Of Metastatic Prostatic Carcinoma,” The Prostate, 14:209-220 (1989).
  • In some cases, the monoclonal antibodies developed for detection and/or treatment of prostate cancer recognize antigens specific to malignant prostatic tissues. Such antibodies are thus used to distinguish malignant prostatic tissue (for treatment or detection) from benign prostatic tissue. See U.S. Pat. No. 4,970,299 to Bazinet et al. and U.S. Pat. No. 4,902,615 to Freeman et al. [0022]
  • Other monoclonal antibodies react with surface antigens on all prostate epithelial cells whether cancerous or benign. See U.S. Pat. Nos. 4,446,122 and Re 33,405 to Chu et al., U.S. Pat. No. 4,863,851 to McEwan et al., and U.S. Pat. No. 5,055,404 to Ueda et al. However, the antigens detected by these monoclonal antibodies are present in the blood and, therefore, compete with antigens at tumor sites for the monoclonal antibodies. This causes background noise which makes the use of such antibodies inadequate for in vivo imaging. In therapy, such antibodies, if bound to a cytotoxic agent, could be harmful to other organs. [0023]
  • Horoszewicz et al., “Monoclonal Antibodies to a New Antigenic Marker in Epithelial Prostatic Cells and Serum of Prostatic Cancer Patients,” [0024] Anticancer Research, 7:927-936 (1987) (“Horoszewicz”) and U.S. Pat. No. 5,162,504 to Horoszewicz describe an antibody, designated 7E11, which recognizes prostate specific membrane antigen (“PSMA”). Israeli et al., “Molecular Cloning of a Complementary DNA Encoding a Prostate-specific Membrane Antigen,” Cancer Research, 53:227-230 (1993) (“Israeli”) describes the cloning and sequencing of PSMA and reports that PSMA is prostate-specific and shows increased expression levels in metastatic sites and in hormone-refractory states. Other studies have indicated that PSMA is more strongly expressed in prostate cancer cells relative to cells from the normal prostate or from a prostate with benign hyperplasia. Furthermore, PSMA is not found in serum (Troyer et al., “Detection and Characterization of the Prostate-Specific Membrane Antigen (PSMA) in Tissue Extracts and Body Fluids,” Int. J. Cancer, 62:552-558 (1995)).
  • These characteristics make PSMA an attractive target for antibody mediated targeting for imaging and therapy of prostate cancer. Imaging studies using indium-labeled 7E11 have indicated that the antibody localizes quite well to both the prostate and to sites of metastasis. In addition, 7E11 appears to have clearly improved sensitivity for detecting lesions compared to other currently available imaging techniques, such as CT and MR imaging or bone scan. Bander, “Current Status of Monoclonal Antibodies for Imaging and Therapy of Prostate Cancer,” [0025] Sem. In Oncology, 21:607-612 (1994).
  • However, the use of 7E11 and other known antibodies to PSMA to mediate imaging and therapy has several disadvantages. First, PSMA is an integral membrane protein known to have a short intracellular tail and a long extracellular domain. Biochemical characterization and mapping (Troyer et al., “Biochemical Characterization and Mapping of the 7E11-C5.3 Epitope of the Prostate-specific Membrane Antigen,” [0026] Urol. Oncol., 1:29-37 (1995)) have shown that the epitope or antigenic site to which the 7E11 antibody binds is present on the intracellular portion of the molecule. Because antibody molecules do not, under normal circumstances, cross the cell membrane unless they bind to the extracellular portion of a molecule and become translocated intracellularly, the 7E11 antibody does not have access to its antigenic target site in an otherwise healthy, viable cell.
  • Consequently, imaging using 7E11 is limited to the detection of dead cells within tumor deposits. Additionally, the therapeutic use of the 7E11 antibody is limited, because only cells that are already dead or tissue containing a large proportion of dead cells can be effectively targeted. [0027]
  • The present invention is directed to overcoming the deficiencies of prior art antibodies in diagnosing and treating prostate cancer. [0028]
  • SUMMARY OF THE INVENTION
  • One aspect of the present invention relates to a method of ablating or killing normal, benign hyperplastic, and cancerous prostate epithelial cells. The process involves providing a biological agent which recognizes an extracellular domain of prostate specific membrane antigen. The biological agent can be used alone or can be bound to a substance effective to kill the cells upon binding of the biological agent to the cells. These biological agents are then contacted with the cells under conditions effective to permit both binding of the biological agent to the extracellular domain of the prostate specific membrane antigen and killing or ablating of the cells. [0029]
  • In another particularly preferred embodiment of the method of ablating or killing normal, benign hyperplastic, and cancerous prostate epithelial cells in accordance with the present invention, the biological agent binds to and is internalized with the prostate specific membrane antigen of such cells. Preferred biological agents for use in the method of ablating or killing normal, benign hyperplastic, and cancerous prostate epithelial cells in accordance with the present invention are antibodies or binding portions thereof, probes, or ligands. [0030]
  • Another aspect of the present invention relates to a method of detecting normal, benign hyperplastic, and cancerous prostate epithelial cells or portions thereof in a biological sample. This method involves providing a biological agent which binds to an extracellular domain of prostate specific membrane antigen. The biological agent is bound to a label effective to permit detection of the cells or portions thereof upon binding of the biological agent to the cells or portions thereof. The biological sample is contacted with the biological agent having a label under conditions effective to permit binding of the biological agent to the extracellular domain of the prostate specific membrane antigen of any of the cells or portions thereof in the biological sample. The presence of any cells or portions thereof in the biological sample is detected by detection of the label. [0031]
  • In a particularly preferred embodiment of the method of detecting normal, benign hyperplastic, and cancerous prostate epithelial cells in accordance with the present invention, the biological agent binds to and is internalized with the prostate specific membrane antigen of such cells. Preferred biological agents for use in the method of detecting normal, benign hyperplastic, and cancerous prostate epithelial cells in accordance with the present invention are antibodies or binding portions thereof, probes, or ligands. [0032]
  • Another aspect of the present invention pertains to a biological agent that recognizes an extracellular domain of prostate specific membrane antigen. In a preferred embodiment, the isolated biological agent binds to and is internalized with the prostate specific membrane antigen. Preferred isolated biological agents which recognize an extracellular domain of prostate specific membrane antigen in accordance with the present invention are isolated antibodies or binding portions thereof, probes, or ligands. Hybridoma cell lines that produce monoclonal antibodies of these types are also disclosed. [0033]
  • The biological agents of the present invention recognize the extracellular domain of antigens of normal, benign hyperplastic, and cancerous prostate epithelial cells. Unlike the 7E11 antibody, which recognizes an epitope of prostate-associated antigens which are exposed extracellularly only after cell lysis, the biological agents of the present invention bind to antigenic epitopes which are extracellularly exposed in living prostate cells. Using the biological agents of the present invention, living, unfixed normal, benign hyperplastic, and cancerous prostate epithelial cells can be targeted, which makes treatment and diagnosis more effective. In a preferred embodiment, the biological agents of the present invention also bind to and are internalized with the prostate specific membrane antigen, which permits the therapeutic use of intracellularly acting cytotoxic agents.[0034]
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG. 1 is an immuno-electron micrograph of gold-labeled monoclonal antibody J591 on the surface of LNCaP cells prior to incubation. [0035]
  • FIG. 2 is an immuno-electron micrograph of gold-labeled monoclonal antibody J591 after 5 minutes incubation at 37° C. LNCaP cells. [0036]
  • FIG. 3 is an immuno-electron micrograph of gold-labeled monoclonal antibody J591 after 10 minutes incubation at 37° C. LNCaP cells. [0037]
  • FIG. 4 is an immuno-electron micrograph of gold-labeled monoclonal antibody J591 after 15 minutes incubation at 37° C. LNCaP cells. [0038]
  • FIG. 5 is an immuno-electron micrograph of gold-labeled monoclonal antibody J591 after 15 minutes at 37° C. showing J591 within endosomes. [0039]
  • FIG. 6 summarizes the sequencing strategy of the heavy chain of monoclonal antibody J591. [0040]
  • FIG. 7 shows the nucleotide sequence of the heavy chain of monoclonal antibody J591 (designated SEQ. ID. No. 1), the nucleotide sequence of the corresponding reverse, non-coding strand (designated SEQ. ID. No. 2), and the corresponding deduced amino acid sequences (designated SEQ. ID. Nos. 3, 4, and 5). [0041]
  • FIG. 8 is a comparison of the heavy chain of monoclonal antibody J591 with the consensus sequence for Mouse Heavy Chains Subgroup IIA. [0042]
  • FIG. 9 summarizes the sequencing strategy of the kappa light chain of monoclonal antibody J591. [0043]
  • FIG. 10 shows the nucleotide sequences of the kappa light chain of monoclonal antibody J591 (designated SEQ. ID. No. 9), the nucleotide sequence of the corresponding reverse, non-coding strand (designated SEQ. ID. No. 10), and the corresponding deduced amino acid sequence (designated SEQ. ID. Nos. 11, 12, and 13). [0044]
  • FIG. 11 is a comparison of the kappa light chain of monoclonal antibody J591 with the consensus sequence for Mouse Kappa Chains Subgroup V.[0045]
  • DETAILED DESCRIPTION OF THE INVENTION
  • One aspect of the present invention relates to a method of ablating or killing normal, benign hyperplastic, and cancerous prostate epithelial cells. The process involves providing a biological agent, such as an antibody or binding portion thereof, probe, or ligand, which binds to an extracellular domain of prostate specific membrane antigen of (i.e., a portion of prostate specific membrane antigen which is external to) such cells. The biological agent can be used alone or can be bound to a substance effective to kill the cells upon binding of the biological agent to the cells. These biological agents are then contacted with the cells under conditions effective to permit both binding of the biological agent to the extracellular domain of the prostate specific membrane antigen and killing or ablating of the cells. In its preferred form, such contacting is carried out in a living mammal by administering the biological agent to the mammal under conditions effective to permit both binding of the biological agent to the extracellular domain of the prostate specific membrane antigen and killing or ablating of the cells. Such administration can be carried out orally or parenterally. [0046]
  • In a particularly preferred embodiment of the method of ablating or killing normal, benign hyperplastic, and cancerous prostate epithelial cells in accordance with the present invention, the biological agent binds to and is internalized with the prostate specific membrane antigen of such cells. Again, the biological agent can be used alone. Alternatively, the biological agent can be bound to a substance effective to kill the cells upon binding of the biological agent to prostate specific membrane antigen and upon internalization of the biological agent with the prostate specific membrane antigen. [0047]
  • The mechanism by which the biological agent is internalized with the prostate specific membrane antigen is not critical to the practice of the present invention. For example, the biological agent can induce internalization of the prostate specific membrane antigen. Alternatively, internalization of the biological agent can be the result of routine internalization of prostate specific membrane antigen. [0048]
  • Another aspect of the present invention relates to a method of detecting normal, benign hyperplastic, and cancerous epithelial cells or portions thereof in a biological sample. This method involves providing a biological agent, such as an antibody or binding portion thereof, probe, or ligand, which binds to an extracellular domain of prostate specific membrane antigen of such cells. The biological agent is bound to a label effective to permit detection of the cells or portions (e.g., prostate specific membrane antigen or fragments thereof liberated from such normal, benign hyperplastic, and cancerous cells) thereof upon binding of the biological agent to the cells or portions thereof. The biological sample is contacted with the biological agent having a label under conditions effective to permit binding of the biological agent to the extracellular domain of the prostate specific membrane antigen of any of the cells or portions thereof in the biological sample. The presence of any cells or portions thereof in the biological sample is detected by detection of the label. In its preferred form, such contacting is carried out in a living mammal and involves administering the biological agent to the mammal under conditions effective to permit binding of the biological agent to the prostate specific membrane antigen of any of the cells or portions thereof in the biological sample. Again, such administration can be carried out orally or parenterally. [0049]
  • The method of the present invention can be used to screen patients for diseases associated with the presence of normal, benign hyperplastic, and cancerous epithelial cells or portions thereof. Alternatively, it can be used to identify the recurrence of such diseases, particularly when the disease is localized in a particular biological material of the patient. For example, recurrence of prostatic disease in the prostatic fossa may be encountered following radical prostatectomy. Using the method of the present invention, this recurrence can be detected by administering a short range radiolabeled antibody to the mammal and then detecting the label rectally, such as with a transrectal detector probe. [0050]
  • Alternatively, the contacting step can be carried out in a sample of serum or urine or other body fluids, such as to detect the presence of PSMA in the body fluid. When the contacting is carried out in a serum or urine sample, it is preferred that the biological agent recognize substantially no antigens circulating in the blood other than PSMA. Since intact prostate cells do not excrete or secrete PSMA into the extracellular environment, detecting PSMA in serum, urine, or other body fluids generally indicates that prostate cells are being lysed. Thus, the biological agents and methods of the present invention can be used to determine the effectiveness of a prostate cancer treatment protocol by monitoring the level of PSMA in serum, urine or other body fluids. [0051]
  • In a particularly preferred embodiment of the method of detecting normal, benign hyperplastic, and cancerous prostate epithelial cells in accordance with the present invention, the biological agent, such as the antibody or binding portion thereof, probe, or ligand, binds to and is internalized with the prostate specific membrane antigen of such cells. Again, the biological agent is bound to a label effective to permit detection of the cells or portions thereof upon binding of the biological agent to and internalization of the biological agent with the prostate specific membrane antigen. [0052]
  • As indicated above, biological agents suitable for either killing, ablating, or detecting normal, benign hyperplastic, and cancerous prostate epithelial cells include antibodies, such as monoclonal or polyclonal antibodies. In addition, antibody fragments, half-antibodies, hybrid derivatives, probes, and other molecular constructs may be utilized. These biological agents, such as antibodies, binding portions thereof, probes, or ligands, bind to extracellular domains of prostate specific membrane antigens or portions thereof in normal, benign hyperplastic, and cancerous prostate epithelial cells. As a result, the biological agents bind to all such cells, not only to cells which are fixed or cells whose intracellular antigenic domains are otherwise exposed to the extracellular environment. Consequently, binding of the biological agents is concentrated in areas where there are prostate epithelial cells, irrespective of whether these cells are fixed or unfixed, viable or necrotic. Additionally or alternatively, these biological agents, such as antibodies, binding portions thereof, probes, or ligands, bind to and are internalized with prostate specific membrane antigens or portions thereof in normal, benign hyperplastic, and cancerous prostate epithelial cells. [0053]
  • Monoclonal antibody production may be effected by techniques which are well-known in the art. Basically, the process involves first obtaining immune cells (lymphocytes) from the spleen of a mammal (e.g., mouse) which has been previously immunized with the antigen of interest either in vivo or in vitro. The antibody-secreting lymphocytes are then fused with (mouse) myeloma cells or transformed cells, which are capable of replicating indefinitely in cell culture, thereby producing an immortal, immunoglobulin-secreting cell line. The resulting fused cells, or hybridomas, are cultured, and the resulting colonies screened for the production of the desired monoclonal antibodies. Colonies producing such antibodies are cloned, and grown either in vivo or in vitro to produce large quantities of antibody. A description of the theoretical basis and practical methodology of fusing such cells is set forth in Kohler and Milstein, [0054] Nature 256:495 (1975), which is hereby incorporated by reference.
  • Mammalian lymphocytes are immunized by in vivo immunization of the animal (e.g., a mouse) with the protein or polypeptide of the present invention. Such immunizations are repeated as necessary at intervals of up to several weeks to obtain a sufficient titer of antibodies. Following the last antigen boost, the animals are sacrificed and spleen cells removed. [0055]
  • Fusion with mammalian myeloma cells or other fusion partners capable of replicating indefinitely in cell culture is effected by standard and well-known techniques, for example, by using polyethylene glycol (“PEG”) or other fusing agents (See Milstein and Kohler, [0056] Eur. J. Immunol. 6:511 (1976), which is hereby incorporated by reference). This immortal cell line, which is preferably murine, but may also be derived from cells of other mammalian species, including but not limited to rats and humans, is selected to be deficient in enzymes necessary for the utilization of certain nutrients, to be capable of rapid growth, and to have good fusion capability. Many such cell lines are known to those skilled in the art, and others are regularly described.
  • Procedures for raising polyclonal antibodies are also well known. Typically, such antibodies can be raised by administering the protein or polypeptide of the present invention subcutaneously to New Zealand white rabbits which have first been bled to obtain pre-immune serum. The antigens can be injected at a total volume of 100 Al per site at six different sites. Each injected material will contain synthetic surfactant adjuvant pluronic polyols, or pulverized acrylamide gel containing the protein or polypeptide after SDS-polyacrylamide gel electrophoresis. The rabbits are then bled two weeks after the first injection and periodically boosted with the same antigen three times every six weeks. A sample of serum is then collected 10 days after each boost. Polyclonal antibodies are then recovered from the serum by affinity chromatography using the corresponding antigen to capture the antibody. Ultimately, the rabbits are euthenized with pentobarbital 150 mg/Kg IV. This and other procedures for raising polyclonal antibodies are disclosed in E. Harlow, et. al., editors, [0057] Antibodies: A Laboratory Manual (1988), which is hereby incorporated by reference.
  • In addition to utilizing whole antibodies, the processes of the present invention encompass use of binding portions of such antibodies. Such binding portions include Fab fragments, F(ab′)[0058] 2 fragments, and Fv fragments. These antibody fragments can be made by conventional procedures, such as proteolytic fragmentation procedures, as described in J. Goding, Monoclonal Antibodies: Principles and Practice, pp. 98-118 (N.Y. Academic Press 1983), which is hereby incorporated by reference.
  • Alternatively, the processes of the present invention can utilize probes or ligands found either in nature or prepared synthetically by recombinant DNA procedures or other biological or molecular procedures. Suitable probes or ligands are molecules which bind to the extracellular domains of prostate specific membrane antigens identified by the monoclonal antibodies of the present invention. Other suitable probes or ligands are molecules which bind to and are internalized with prostate specific membrane antigens. Such probes or ligands can be, for example, proteins, peptides, lectins, or nucleic acid probes. [0059]
  • It is particularly preferred to use the monoclonal antibodies identified below in Table 1. [0060]
    TABLE 1
    ATCC Designation for
    Monoclonal Antibody Name Hybridoma Cell Line
     E99 HB-12101
    J415 HB-12109
    J533 HB-12127
    J591 HB-12126
  • These antibodies can be used alone or as a component in a mixture with other antibodies or other biological agents to treat or image prostate epithelial cells with varying surface antigen characteristics. [0061]
  • Regardless of whether the biological agents are used for treatment or therapy, they can be administered orally, parenterally, subcutaneously, intravenously, intramuscularly, intraperitoneally, by intranasal instillation, by intracavitary or intravesical instillation, intraocularly, intraarterially, intralesionally, or by application to mucous membranes, such as, that of the nose, throat, and bronchial tubes. They may be administered alone or with pharmaceutically or physiologically acceptable carriers, excipients, or stabilizers, and can be in solid or liquid form such as, tablets, capsules, powders, solutions, suspensions, or emulsions. [0062]
  • The solid unit dosage forms can be of the conventional type. The solid form can be a capsule, such as an ordinary gelatin type containing the biological agent, such as an antibody or binding portion thereof, of the present invention and a carrier, for example, lubricants and inert fillers such as, lactose, sucrose, or cornstarch. In another embodiment, these compounds are tableted with conventional tablet bases such as lactose, sucrose, or cornstarch in combination with binders like acacia, cornstarch, or gelatin, disintegrating agents such as, cornstarch, potato starch, or alginic acid, and a lubricant like stearic acid or magnesium stearate. [0063]
  • The biological agent of the present invention may also be administered in injectable dosages by solution or suspension of these materials in a physiologically acceptable diluent with a pharmaceutical carrier. Such carriers include sterile liquids such as water and oils, with or without the addition of a surfactant and other pharmaceutically and physiologically acceptable carrier, including adjuvants, excipients or stabilizers. Illustrative oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, or mineral oil. In general, water, saline, aqueous dextrose and related sugar solution, and glycols such as, propylene glycol or polyethylene glycol, are preferred liquid carriers, particularly for injectable solutions. [0064]
  • For use as aerosols, the biological agent of the present invention in solution or suspension may be packaged in a pressurized aerosol container together with suitable propellants, for example, hydrocarbon propellants like propane, butane, or isobutane with conventional adjuvants. The materials of the present invention also may be administered in a non-pressurized form such as in a nebulizer or atomizer. [0065]
  • The biological agents may be utilized to detect normal, benign hyperplastic, and cancerous prostate epithelial cells in vivo. This is achieved by labeling the biological agent, administering the labeled biological agent to a mammal, and then imaging the mammal. [0066]
  • Examples of labels useful for diagnostic imaging in accordance with the present invention are radiolabels such as [0067] 131I, 111In, 123I, 99mTc, 32P, 125I, 3H, 14C, and 188Rh, fluorescent labels such as fluorescein and rhodamine, nuclear magnetic resonance active labels, positron emitting isotopes detectable by a positron emission tomography (“PET”) scanner, chemiluminescers such as luciferin, and enzymatic markers such as peroxidase or phosphatase. Short-range radiation emitters, such as isotopes detectable by short-range detector probes, such as a transrectal probe, can also be employed. These isotopes and transrectal detector probes, when used in combination, are especially useful in detecting prostatic fossa recurrences and pelvic nodal disease. The biological agent can be labeled with such reagents using techniques known in the art. For example, see Wensel and Meares, Radioimmunoimaging and Radioimmunotherapy, Elsevier, N.Y. (1983), which is hereby incorporated by reference, for techniques relating to the radiolabeling of antibodies. See also, D. Colcher et al., “Use of Monoclonal Antibodies as Radiopharmaceuticals for the Localization of Human Carcinoma Xenografts in Athymic Mice”, Meth. Enzymol. 121: 802-816 (1986), which is hereby incorporated by reference.
  • A radiolabeled biological agent of this invention can be used for in vitro diagnostic tests. The specific activity of a tagged biological agent, such as a tagged antibody, binding portion thereof, probe, or ligand, depends upon the half-life, the isotopic purity of the radioactive label, and how the label is incorporated into the biological agent. Table 2 lists several commonly-used isotopes, their specific activities and half-lives. In immunoassay tests, the higher the specific activity, in general, the better the sensitivity. [0068]
    TABLE 2
    Specific Activity of Pure
    Isotope Isotope (Curies/mole) Half-Life
     14C 6.25 × 101 5720 years
     3H 2.01 × 104 12.5 years
     35S 1.50 × 106 87 days
    125I 2.18 × 106 60 days
     32P 3.16 × 106 14.3 days
    131I 1.62 × 107 8.1 days
  • Procedures for labeling biological agents with the radioactive isotopes listed in Table 2 are generally known in the art. Tritium labeling procedures are described in U.S. Pat. No. 4,302,438, which is hereby incorporated by reference. Iodinating, tritium labeling, and [0069] 35S labeling procedures especially adapted for murine monoclonal antibodies are described by Goding, J. W. (supra, pp 124-126) and the references cited therein, which are hereby incorporated by reference. Other procedures for iodinating biological agents, such as antibodies, binding portions thereof, probes, or ligands, are described by Hunter and Greenwood, Nature 144:945 (1962), David et al., Biochemistry 13:1014-1021 (1974), and U.S. Pat. Nos. 3,867,517 and 4,376,110, which are hereby incorporated by reference. Radiolabeling elements which are useful in imaging include 123I, 131I, 111In, and 99mTc, for example. Procedures for iodinating biological agents are described by Greenwood, F. et al., Biochem. J. 89:114-123 (1963); Marchalonis, J., Biochem. J. 113:299-305 (1969); and Morrison, M. et al., Immunochemistry, 289-297 (1971), which are hereby incorporated by reference. Procedures for 99mTc-labeling are described by Rhodes, B. et al. in Burchiel, S. et al. (eds.), Tumor Imaging: The Radioimmunochemical Detection of Cancer, New York: Masson 111-123 (1982) and the references cited therein, which are hereby incorporated by reference. Procedures suitable for 111In-labeling biological agents are described by Hnatowich, D. J. et al., J. Immul. Methods, 65:147-157 (1983), Hnatowich, D. et al., J. Applied Radiation, 35:554-557 (1984), and Buckley, R. G. et al., F.E.B.S. 166:202-204 (1984), which are hereby incorporated by reference.
  • In the case of a radiolabeled biological agent, the biological agent is administered to the patient, is localized to the tumor bearing the antigen with which the biological agent reacts, and is detected or “imaged” in vivo using known techniques such as radionuclear scanning using e.g., a gamma camera or emission tomography. See e.g., A. R. Bradwell et al., “Developments in Antibody Imaging”, [0070] Monoclonal Antibodies for Cancer Detection and Therapy, R. W. Baldwin et al., (eds.), pp. 65-85 (Academic Press 1985), which is hereby incorporated by reference. Alternatively, a positron emission transaxial tomography scanner, such as designated Pet VI located at Brookhaven National Laboratory, can be used where the radiolabel emits positrons (e.g., 11C, 18F, 15O, and 13N)
  • Fluorophore and chromophore labeled biological agents can be prepared from standard moieties known in the art. Since antibodies and other proteins absorb light having wavelengths up to about 310 nm, the fluorescent moieties should be selected to have substantial absorption at wavelengths above 310 nm and preferably above 400 nm. A variety of suitable fluorescers and chromophores are described by Stryer, Science, 162:526 (1968) and Brand, L. et al., [0071] Annual Review of Biochemistry, 41:843-868 (1972), which are hereby incorporated by reference. The biological agents can be labeled with fluorescent chromophore groups by conventional procedures such as those disclosed in U.S. Pat. Nos. 3,940,475, 4,289,747, and 4,376,110, which are hereby incorporated by reference.
  • One group of fluorescers having a number of the desirable properties described above are the xanthene dyes, which include the fluoresceins derived from 3,6-dihydroxy-9-henylxanthhydrol and resamines and rhodamines derived from 3,6-diamino-9-phenylxanthydrol and lissanime rhodamine B. The rhodamine and fluorescein derivatives of 9-o-carboxyphenylxanthhydrol have a 9-o-carboxyphenyl group. Fluorescein compounds having reactive coupling groups such as amino and isothiocyanate groups such as fluorescein isothiocyanate and fluorescamine are readily available. Another group of fluorescent compounds are the naphthylamines, having an amino group in the α or β position. [0072]
  • Biological agents can be labeled with fluorchromes or chromophores by the procedures described by Goding, J. (supra, pp 208-249). The biological agents can be labeled with an indicating group containing the NMR-active [0073] 19F atom, or a plurality of such atoms inasmuch as (i) substantially all of naturally abundant fluorine atoms are the 19F isotope and, thus, substantially all fluorine-containing compounds are NMR-active; (ii) many chemically active polyfluorinated compounds such as trifluoracetic anhydride are commercially available at relatively low cost, and (iii) many fluorinated compounds have been found medically acceptable for use in humans such as the perfluorinated polyethers utilized to carry oxygen as hemoglobin replacements. After permitting such time for incubation, a whole body NMR determination is carried out using an apparatus such as one of those described by Pykett, Scientific American, 246:78-88 (1982), which is hereby incorporated by reference, to locate and image prostate epithelial cells.
  • In cases where it is important to distinguish between regions containing live and dead prostate epithelial cells or to distinguish between live and dead prostate epithelial cells, the antibodies of the present invention (or other biological agents of the present invention), labeled as described above, can be coadministered along with an antibody or other biological agent which recognizes only living or only dead prostate epithelial cells labeled with a label which can be distinguished from the label used to label the subject antibody. By monitoring the concentration of the two labels at various locations or times, spatial and temporal concentration variations of living and dead normal, benign hyperplastic, and cancerous prostate epithelial cells can be ascertained. In particular, this method can be carried out using the labeled antibodies of the present invention, which recognize both living and dead epithelial prostate cells, and labeled 7E11 antibodies, which recognize only dead epithelial prostate cells. [0074]
  • The biological agents can also be utilized to kill or ablate normal, benign hyperplastic, and cancerous prostate epithelial cells in vivo. This involves using the biological agents by themselves or with a cytotoxic drug to which the biological agents recognizing normal, benign hyperplastic, and cancerous prostate epithelial cells are bound. This involves administering the biological agents bonded to a cytotoxic drug to a mammal requiring such treatment. Since the biological agents recognize prostate epithelial cells, any such cells to which the biological agents bind are destroyed. Although such administration may destroy normal prostate epithelial cells, this is not problematic, because the prostate is not required for life or survival. Although the prostate may indirectly contribute to fertility, this is not likely to be a practical consideration in patients receiving the treatment of the present invention. [0075]
  • The biological agents of the present invention may be used to deliver a variety of cytotoxic drugs including therapeutic drugs, a compound emitting radiation, molecules of plants, fungal, or bacterial origin, biological proteins, and mixtures thereof. The cytotoxic drugs can be intracellularly acting cytotoxic drugs, such as short-range radiation emitters, including, for example, short-range, high-energy α-emitters. [0076]
  • Enzymatically active toxins and fragments thereof are exemplified by diphtheria toxin A fragment, nonbinding active fragments of diphtheria toxin, exotoxin A (from [0077] Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, α-sacrin, certain Aleurites fordii proteins, certain Dianthin proteins, Phytolacca americana proteins (PAP, PAPII and PAP-S), Morodica charantia inhibitor, curcin, crotin, Saponaria officinalis inhibitor, gelonin, mitogillin, restrictocin, phenomycin, and enomycin, for example. Procedures for preparing enzymatically active polypeptides of the immunotoxins are described in WO84/03508 and WO85/03508, which are hereby incorporated by reference. Certain cytotoxic moieties are derived from adriamycin, chlorambucil, daunomycin, methotrexate, neocarzinostatin, and platinum, for example.
  • Procedures for conjugating the biological agents with the cytotoxic agents have been previously described. Procedures for conjugating chlorambucil with antibodies are described by Flechner, I,. [0078] European Journal of Cancer, 9:741-745 (1973); Ghose, T. et al., British Medical Journal, 3:495-499 (1972); and Szekerke, M., et al., Neoplasma, 19:211-215 (1972), which are hereby incorporated by reference. Procedures for conjugating daunomycin and adriamycin to antibodies are described by Hurwitz, E. et al., Cancer Research, 35:1175-1181 (1975) and Arnon, R. et al. Cancer Surveys, 1:429-449 (1982), which are hereby incorporated by reference. Procedures for preparing antibody-ricin conjugates are described in U.S. Pat. No. 4,414,148 and by Osawa, T., et al. Cancer Surveys, 1:373-388 (1982) and the references cited therein, which are hereby incorporated by reference. Coupling procedures as also described in EP 86309516.2, which is hereby incorporated by reference.
  • In a particularly preferred embodiment of the present invention, a first biological agent is conjugated with a prodrug which is activated only when in close proximity with a prodrug activator. The prodrug activator is conjugated with a second biological agent according to the present invention, preferably one which binds to a non-competing site on the prostate specific membrane antigen molecule. Whether two biological agents bind to competing or non-competing binding sites can be determined by conventional competitive binding assays. For example, monoclonal antibodies J591, J533, and E99 bind to competing binding sites on the prostate specific membrane antigen molecule. Monoclonal antibody J415, on the other hand, binds to a binding site which is non-competing with the site to which J591, J533, and E99 bind. Thus, for example, the first biological agent can be one of J591, J533, and E99, and the second biological agent can be J415. Alternatively, the first biological agent can be J415, and the second biological agent can be one of J591, J533, and E99. Drug-prodrug pairs suitable for use in the practice of the present invention are described in Blakely et al., “ZD2767, an Improved System for Antibody-directed Enzyme Prodrug Therapy That Results in Tumor Regressions in Colorectal Tumor Xenografts,” [0079] Cancer Research, 56:3287-3292 (1996), which is hereby incorporated by reference.
  • Alternatively, the biological agent can be coupled to high energy radiation emitters, for example, a radioisotope, such as [0080] 131I, a γ-emitter, which, when localized at the tumor site, results in a killing of several cell diameters. See, e.g., S. E. Order, “Analysis, Results, and Future Prospective of the Therapeutic Use of Radiolabeled Antibody in Cancer Therapy”, Monoclonal Antibodies for Cancer Detection and Therapy, R. W. Baldwin et al. (eds.), pp 303-316 (Academic Press 1985), which is hereby incorporated by reference. Other suitable radioisotopes include α-emitters, such as 212Bi, 213Bi, and 211At, and β-emitters, such as 186Re and 90Y. Radiotherapy is expected to be particularly effective, because prostate cancer is a relatively radiosensitive tumor.
  • Where the biological agents are used alone to kill or ablate prostate epithelial cells, such killing or ablation can be effected by initiating endogenous host immune functions, such as complement-mediated or antibody-dependent cellular cytotoxicity. [0081]
  • The biological agent of the present invention can be used and sold together with equipment, as a kit, to detect the particular label. [0082]
  • Biological agents of the present invention can be used in conjunction with other therapeutic treatment modalities. Such other treatments include surgery, radiation, cryosurgery, thermotherapy, hormone treatment, chemotherapy, vaccines, and other immunotherapies. [0083]
  • Also encompassed by the present invention is a method of killing or ablating which involves using the biological agents for prophylaxis. For example, these materials can be used to prevent or delay development or progression of prostate cancer. [0084]
  • Use of the prostate cancer therapy of the present invention has a number of benefits. Since the biological agents according to the present invention only target prostate epithelial cells, other tissue is spared. As a result, treatment with such biological agents is safer, particularly for elderly patients. Treatment according to the present invention is expected to be particularly effective, because it directs high levels of biological agents, such as antibodies or binding portions thereof, probes, or ligands, to the bone marrow and lymph nodes where prostate cancer metastases predominate. Moreover, tumor sites for prostate cancer tend to be small in size and, therefore, easily destroyed by cytotoxic agents. Treatment in accordance with the present invention can be effectively monitored with clinical parameters such as serum prostate specific antigen and/or pathological features of a patient's cancer, including stage, Gleason score, extracapsular, seminal, vesicle or perineural invasion, positive margins, involved lymph nodes, etc. Alternatively, these parameters can be used to indicate when such treatment should be employed. [0085]
  • Because the biological agents of the present invention bind to living prostate cells, therapeutic methods using these biological agents are much more effective than those which target lysed prostate cells. For the same reasons, diagnostic and imaging methods which determine the location of living normal, benign hyperplastic, or cancerous prostate epithelial cells are much improved by employing the biological agents of the present invention. In addition, the ability to differentiate between living and dead prostate cells can be advantageous, especially to monitor the effectiveness of a particular treatment regimen. [0086]
  • Hybridomas E99, J415, J533, and J591 have been deposited pursuant to, and in satisfaction of, the requirements of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure with the American Type Culture Collection (“A.T.C.C.”) at 12301 Parklawn Drive, Rockville, Md. 20852. Hybridoma E99 was deposited on May 2, 1996, and received A.T.C.C. Designation Number HB-12101. Hybridoma J415 was deposited on May 30, 1996, and received A.T.C.C. Designation Number HB-12109. Hybridomas J533 and J591 were deposited on Jun. 6, 1996, and received A.T.C.C. Designation Numbers HB-12127 and HB-12126, respectively. [0087]
  • The present invention is further illustrated by the following examples. [0088]
  • EXAMPLES Example 1 Human Tissues
  • Fresh specimens of benign and malignant tissues were obtained from the Department of Pathology of New York Hospital Cornell University Medical Center (“NYH-CUMC”), [0089]
  • Example 2 Tissue Culture
  • Cultured cell lines of human cancers were obtained from the Laboratory of Urological Oncology of NYH-CUMC. The prostate cancer cell lines PC-3 (Mickey, D. D., et al., “Characterization Of A Human Prostate Adenocarcinoma Cell Line (DU145) As A Monolayer Culture And As A Solid Tumor In Athymic Mice,” [0090] Prog. Clin. Biol. Res., 37:67-84 (1980), which is hereby incorporated by reference), DU-145 (Mickey, D. D., et al., “Characterization Of A Human Prostate Adenocarcinoma Cell Line (DU145) As A Monolayer Culture And As A Solid Tumor In Athymic Mice,” Prog. Clin. Biol. Res., 37:67-84 (1980), which is hereby incorporated by reference), and LNCaP (Horoszewicz, J. S., et al., “LNCaP Model Of Human Prostatic Carcinoma,” Cancer Res., 43:1809-1818 (1983), which is hereby incorporated by reference) were obtained from the American Type Culture Collection (Rockville, Md.). Hybridomas were initially cloned in RPMI-1640 medium supplemented with 10% FCS, 0.1 mM nonessential amino acids, 2 mM L-glutamine, 100 units/ml of penicillin, 100 ug/ml of streptomycin and HAT medium (GIBCO, Grand Island, N.Y.). Subclones were cultured in the same medium without aminopterin.
  • Example 3 Preparation of Mouse Monoclonal Antibodies
  • Female BALB/c mice were immunized intraperitoneally with LNCaP (6×10[0091] 6 cells) three times at 2 week intervals. A final intraperitoneal booster immunization was administered with fresh prostate epithelial cells which had been grown in vitro. Three days later, spleen cells were fused with SP-2 mouse myeloma cells utilizing standard techniques (Ueda, R., et al., “Cell Surface Antigens Of Human Renal Cancer Defined By Mouse Monoclonal Antibodies: Identification Of Tissue-Specific Kidney Glycoproteins,” Proc. Natl. Acad. Sci. USA, 78:5122-5126 (1981), which is hereby incorporated by reference). Supernatants of the resulting clones were screened by rosette and complement cytotoxicity assays against viable LNCaP. Clones which were positive by these assays were screened by immunochemistry vs normal kidney, colon, and prostate. Clones which were LNCap+/NmlKid/colon/prostate+ were selected and subcloned 3 times by limiting dilution. The immunoglobulin class of cultured supernatant from each clone was determined by immunodiffusion using specified rabbit antisera (Calbiochem, San Diego, Calif.). mAbs were purified using the MAPS-II kit (Bio-Rad, Richmond, Calif.).
  • Example 4 Biotinylation of mAbs
  • Purified mAbs were dialyzed in 0.1 M NaHCO[0092] 3 for 2 hours. One ml of mAb at 1 mg/ml was mixed with 0.1 ml of biotinamidocaproate N-hydroxysuccinamide ester (Sigma) in dimethylsulfoxide (1 mg/ml) and stirred for 4 hours at room temperature. Unbound biotin was removed by dialysis against phosphate buffered saline (“PBS”).
  • Example 5 Immunohistochemical Staining
  • Cryostat sections of prostate tissues were placed inside rings of Falcon 3034 plate covers (Becton-Dickenson, Lincoln Park, N.J.) previously coated with 0.45% gelatin solution as described in Marusich, M. F., “A Rapid Method For Processing Very Large Numbers Of Tissue Sections For Immunohistochemical Hybridoma Screening,” [0093] J. Immunol. Methods, 111:143-145 (1988), which is hereby incorporated by reference. Plates were stored at −80° C. Cryostat sections were fixed with 2% paraformaldehyde in PBS for 10 min at room temperature, and, after washing with PBS, endogenous peroxidase activity was blocked by treatment with 0.3% hydrogen peroxide in PBS for 10 min at room temperature. After sections were incubated with 2% BSA in PBS for 20 min, mAbs were added for 60 min at room temperature. Slides were extensively washed with PBS and incubated with peroxidase-conjugated rabbit anti-mouse Ig (DAKO Corp., Santa Barbara, Calif.) diluted 1:100 in 10% normal human serum in PBS for 60 min at room temperature. After a diaminobenzidine reaction, sections were counterstained with hematoxylin.
  • Example 6 Serological Analysis
  • The anti-mouse immunoglobulin mixed hemadsorption assay was performed as described in Ueda, R., et al., “Cell Surface Antigens Of Human Renal Cancer Defined By Mouse Monoclonal Antibodies: Identification Of Tissue-Specific Kidney Glycoproteins,” [0094] Proc. Natl. Acad. Sci. USA, 78:5122-5126 (1981), which is hereby incorporated by reference. To prepare the indicator cells, anti-mouse Ig (DAKO Corp.) was conjugated to type O human RBC using 0.01% chromium chloride. Serological assays were performed on cells previously plated in Terasaki plates (Nunc, Denmark). Antibodies were incubated with target cells at room temperature for 1 hour. Target cells were then washed, and indicator cells added for 1 hour.
  • Example 7 Immunoprecipitation
  • LNCaP cells (2×10[0095] 7) were biotinylated with biotin-NHSS (at final concentration of 5 mM) for 30 minutes on ice. After washing, the biotinylated cells were resuspended in 1 ml lysis buffer (20 mM Tris/HCl pH 8.0, 1 mM EDTA, 1 mM PMSF, 1% triton X-100) for 30 min on ice. The suspension was centrifuged at 1500 g×100 min at 4° C., and the supernatant was centrifuged at 12,000 rpm×15 min at 4° C. The resulting lysate was preabsorbed with rabbit or goat anti-mouse IgG-coated pansorbin for 1 hour at 4° C. The pre-absorbed lysate was incubated with the mAb overnight at 4° C. Rabbit or goat anti-mouse Ig-coated agarose beads were added for 2 hours at 4° C. and then washed. The beads were resuspended in Tris-base/NaCl, added to sample buffer with 2-mercaptoethanol, and boiled for 5 min. After centrifuging, the supernatant was run on an SDS-PAGE 12% gel. The gel was transferred to a nitrocellulose membrane which was blocked and stained with straptavidin-peroxidase. The membrane was developed with diaminobenzidine (“DAB”).
  • Sequential immunoprecipitation was similar except that the lysate was initially pre-cleared with one mAb overnight at 4° C. A second mAb was then used to immunoprecipitate the pre-cleared lysate. [0096]
  • Approximately 2000 clones were screened, of which four clones were selected as described in Example 3, above. After subcloning, supernatants from the 4 hybridomas, E99, J415, J533, and J591, were assayed by immunofluorescence against viable (i.e. unfixed) LNCaP, immunoprecipitation, and sequential immunoprecipitation to confirm reactivity to PSMA. [0097]
  • The immunofluorescence study using the LNCaP target cell (described originally in Horoszewicz, which is hereby incorporated by reference, to make the 7E11 antibody and the prototype cell line for expression for PSMA) shows that E99 antibody binds to and renders viable LNCaP cells immunofluorescent. This is in contrast to the 7E11 antibody, which, as noted originally in Horoszewicz, which is hereby incorporated by reference, gives only poor or no binding to viable LNCaP cells but exhibits strong binding once the cells are fixed (killed). [0098]
  • The reactivities of the four mAbs with normal human tissues were examined immunohistochemically; these results are presented in Table 3. [0099]
    TABLE 3
    Reactivity of mAbs with human normal tissues
    by indirect immunoperosidase staining
    E99 J415 J533 J591
    Tissues 3) 1) 1) 1)
    Prostate*
    Kidney
    Glomerulus
    Prox. Tubule
    Ureter
    Bladder
    Testis
    Uterus
    Esophagus
    Small Intestine
    Stomach
    Colon
    Spleen
    Thyroid
    Lung
    Pancreas
    Liver
    * BPH 0-3* 0-3* 0-4* 0-4*
    * Prostate Cancer 0-3* 0-3* 0-4* 0-4*
    * LNCaP (scid) 3* 3* 4* 4*
    * LuCaP (scid) 0-2* 0-2* 0-3* 0-3*
  • The above sequential immunoprecipitaion study showed that 7E11, E99, J415, J533, and J591 bind to the same molecule, i.e. PSMA. [0100]
  • Example 8 Western Blot Analysis
  • To confirm that antibodies E99, J415, J533, and J591 precipitate an identical band to the 7E11 antibody (i.e., PSMA), Western Blot analyses were performed. Seminal plasma (400 μg/lane) or LNCaP lysate were loaded into lanes of 12% SDS-PAGE gels. After electrophoresis, the gels are transferred to nitrocellulose membranes. The membranes were blocked with 5% dry milk/Tris-buffered saline-tween 20 (“TBST”) for 60 min at room temperature. After washing, the membranes were incubated with primary mAb for 60 min at room temperature. After repeat washing, the membranes were incubated with sheep anti-mouse-Ig-peroxidase {fraction (1/5000)} in 5% dry milk/TBST for 60 min at room temperature. After repeat washing, the membranes were developed using a chemiluminescent tag designated “ECL” (Amersham Life Sciences, International, Arlington Heights, Ill.) according to the manufacturer's directions. The results of the Western Blot experiment are presented in Table 4. [0101]
    TABLE 4
    Western blot data
    Sample 7E11 E99 J415 J533 J591
    Prostatic
    100 KD 100 KD 100 KD 100 KD 100 KD
    (seminal) band band band band band
    fluid
    LNCaP
    100 KD & 100 KD & 100 KD & 100 KD & 100 KD &
    cell lysate 200 KD 200 KD 200 KD 200 KD 200 KD
    bands bands bands bands bands
  • Example 9 mAb Reactivity to External Domain of PSMA
  • To confirm cell surface (external) expression of the detected PSMA, fresh, viable LNCaP cells were tested, without fixation, in vitro, by immunofluorescence. LNCaP cells were washed and incubated with mAb for 1 hour at room temperature and then with a rabbit anti-mouse Ig-fluorescein (DAKO Corp., Santa Barbara, Calif.). Wells were read with a fluorescent microscope. Negative control consisted of an isotype-matched irrelevant mAb, while an anti-class I MHC mAb served as a positive control. [0102]
  • Immunofluorescence and rosette assay results are presented in Table 5. [0103]
    TABLE 5
    Comparison of 7E11 with new mAbs
    LNCaP
    viable cells 7E11 E99 J415 J533 J591
    Immunofluor- neg 3+ 3+ 4+ 4+
    escence
    Rosette neg + + + +
    assay
    LNCaP-fixed +++ ++++ +++ ++ +++
  • Example 10 Competition Studies
  • A competition study was carried out to determine whether J591, J533, E99, and J415 detected the same or different antigenic sites (epitopes) of the prostate specific membrane antigen molecule using the following procedure. [0104]
  • Plates were coated with LNCaP cell line lysate as a source of prostate specific membrane antigen and washed to remove unbound material. “Cold” (unlabeled) monoclonal antibody was incubated on the plate for 1 hour at room temperature to allow binding to its antigenic site. Subsequently, a second monoclonal antibody, labeled either with biotin or [0105] 125I, was added for an additional hour. Plates were washed to remove unbound material. The amount of the second monoclonal antibody bound to the prostate specific membrane antigen-coated plate was determined either by avidin-alkaline phosphatase in an enzyme-linked immunoassay (in the case of biotin-labeled second monoclonal antibody) or by physically counting the well in a gamma counter (in the case of 125I-labeled second monoclonal antibody). Controls consisted of using the same monoclonal antibody both cold and labeled to define “100% competition” or using monoclonal antibody to a totally different molecule (e.g., monoclonal antibody I-56, which detects inhibin, a prostate related protein different from prostate specific membrane antigen) to define “0% competition”.
  • The results indicated that J591, J533, and E99 each interfere, compete, or block binding of one another but do not block binding of J415 and vice versa. 7E11/CYT356, known to bind PSMA at a different (intracellular) site, did not block any of J591, J533, E99, or J415. [0106]
  • Having pairs of monoclonal antibodies which bind to non-competing sites permits development of antibody sandwich assays for detecting soluble antigens, such as solubilized prostate specific membrane antigen or fragment thereof, in, for example, body fluids. For example, the antigen (e.g., prostate specific membrane antigen or a fragment thereof) could be “captured” from body fluid with J591 and, in another step, detected by labeled J415. [0107]
  • In another setting, e.g. treatment, one could increase antibody binding by using a combination of non-competing monoclonal antibodies. For example, assuming the non-competing sites are each represented once on the prostate specific membrane antigen molecule, adding a combination of J591 plus J415 would bind twice as many monoclonal antibody molecules as either monoclonal antibody alone. Binding two non-competing antigenic binding sites also can result in greater antigen cross-linking and, perhaps, increased internalization. Furthermore, since the two detected sites are physically located on the same prostate specific membrane antigen molecule, the binding of two monoclonal antibody molecules to that single prostate specific membrane antigen molecule puts the two monoclonal antibody molecules in close proximity to each other, a setting which provides optimal drug-prodrug interaction. For example, monoclonal antibody J591 can be conjugated with an inactive pro-drug and J415 can be conjugated with a pro-drug activator. Since prodrug and activator would be bound in close proximity only at the site of prostate specific membrane antigen-expressing cells (e.g., prostate cancer cells), prodrug activation to the active form would occur only at those sites. [0108]
  • Example 11 Microscopy
  • Confocal microscopy and immuno-electron microscopy demonstrated that E99, J591, J533, and J415 are bound to the cell membrane at clathrin-coated pits and then rapidly internalize into endosomes (cytoplasmic vesicles). FIGS. [0109] 1-4 are immuno-electron micrographs which follow the interaction of gold-labeled monoclonal antibody J591 with the cell surface as a function of time. In these figures, the location of the monoclonal antibody is indicated by the black dots.
  • Viable LNCaP cells were incubated with J591 for one hour at 4° C. The cells were washed and then held at 37° C. for 0, 5, 10, or 15 minutes, after which time they were fixed and processed for immuno-electron microscopy. FIG. 1 shows the cell prior to 37° C. incubation. J591 can be seen bound to the cell along the external aspect of the cell membrane. In this Figure, “M” denotes the cell's mitochondria, and “N” denotes its nucleus. FIG. 2 shows the cell after incubation at 37° C. for 5 minutes. The arrow indicates formation of a clathrin-coated pit. In FIG. 3, which shows the cell after a 10 minute 37° C. incubation, pinching off or endocytosis of the clathrin-coated pit can be seen, as indicated by the arrow. FIG. 4 shows that, after incubation at 37° C. for 15 minutes, monoclonal antibody J591 is contained in endocytic vesicles within the cell, as indicated by the arrows. As can be seen in FIG. 5, after incubation at 37° C. for 15 minutes, monoclonal antibody J591 is also contained within endosomes, as indicated by the arrows. [0110]
  • Example 12 Sequencing of the Variable Region of Monoclonal Antibody J591
  • Total RNA was prepared from 10[0111] 7 murine hybridoma J591 cells. A sample of the conditioned medium from these cells was tested for binding to the specific antigen for J591 on prostate cells. The conditioned medium was positive by both ELISA and Western Blot for binding to the antigen.
  • VH and VK cDNA were prepared using reverse transcriptase and mouse κ constant region and mouse IgG constant region primers. The first strand cDNAs were amplified by PCR using a variety of mouse signal sequence primers (6 for VH and 7 for VK). The amplified DNAs were gel-purified and cloned into the vector pT7Blue. [0112]
  • The VH and VK clones obtained were screened for correct inserts by PCR, and the DNA sequence of selected clones was determined by the dideoxy chain termination method. [0113]
  • Excluding the primer region (as the sequence of this depended on the sequence of the primer that was used), all the VH clones obtained gave identical sequence. This sequence was obtained from clones produced with three different 5′ primers. One clone had one base pair change within the signal sequence, and one clone contained an aberrant PCR product. Using the sequencing strategy shown in FIG. 6, the nucleotide sequence for the heavy chain was obtained. It is designated SEQ. ID. No. 1 and is presented in FIG. 7, along with the nucleotide sequence of the corresponding reverse, non-coding strand (designated SEQ. ID. No. 2). These sequences include part of the signal sequence and part of the constant region of the antibody. The corresponding deduced amino acid sequences of J591 VH, designated SEQ. ID. No. 3, SEQ. ID. No. 4, and SEQ. ID. No. 5, are also shown in FIG. 7. The coding strand of the J591 heavy chain's variable region (exclusive of signal sequence and constant region components) has the following nucleotide sequence (designated SEQ. ID. No. 6): [0114]
    GAGGTCCAGCTGCAACAGTCTGGACCTGAACTGGTGAAGCCTGGGACTTCAGTGAGG
    ATATCCTGCAAGACTTCTGGATACACATTCACTGAATATACCATACACTGGGTGAAG
    CAGAGCCATGGAAAGAGCCTTGAGTGGATTGGAAACATCAATCCTAACAATGGTGGT
    ACCACCTACAATCAGAAGTTCGAGGACAAGGCCACATTGACTGTAGACAAGTCCTCC
    AGTACAGCCTACATGGAGCTCCGCAGCCTAACATCTGAGGATTCTGCAGTCTATTAT
    TGTGCAGCTGGTTGGAACTTTGACTACTGGGGCCAAGGCACCACTCTCACAGTCTCC
    TCA
  • The reverse, non-coding strand of the J591 heavy chain's variable region (exclusive of signal sequence and constant region components) has the following nucleotide sequence (designated SEQ. ID. No. 7): [0115]
    TGAGGAGACTGTGAGAGTGGTGCCTTGGCCCCAGTAGTCAAAGTTCCAACCAGCTGC
    ACAATAATAGACTGCAGAATCCTCAGATGTTAGGCTGCGGAGCTCCATGTAGGCTGT
    ACTGGAGGACTTGTCTACAGTCAATGTGGCCTTGTCCTCGAACTTCTGATTGTAGGT
    GGTACCACCATTGTTAGGATTGATGTTTCCAATCCACTCAAGGCTCTTTCCATGGCT
    CTGCTTCACCCAGTGTATGGTATATTCAGTGAATGTGTATCCAGAAGTCTTGCAGGA
    TATCCTCACTGAAGTCCCAGGCTTCACCAGTTCAGGTCCAGACTGTTGCAGCTGGAC
    CTC
  • The protein sequence corresponding to the J591 heavy chain's variable region (exclusive of signal sequence and constant region components) has the following nucleotide sequence (designated SEQ. ID. No. 8): [0116]
    EVQLQQSGPELVKPGTSVRISCKTSGYTFTEYTIHWVKQSHGKSLEWIGNINPNNGG
    TTYNQKFEDKATLTVDKSSSTAYMELRSLTSEDSAVYYCAAGWNFDYWGQGTTLTVS
    S
  • The J591 VH is in Mouse Heavy Chains Subgroup IIA (Kabat et al., [0117] Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services (1991) (“Kabat”), which is hereby incorporated by reference). The sequence of J591 VH is compared to the consensus sequence for this subgroup in FIG. 8.
  • In contrast to the VH, more than one VK sequence was obtained. Out of the 15 VK clones examined, four gave the sequence of an aberrant mouse Igκ from the fusion partner (Carol et al., [0118] Molecular Immunology, 25:991-995 (1988), which is hereby incorporated by reference). These clones originated from two specific 5′ primers. No further work was done with these clones. Of the remaining clones, ten gave identical nucleotide sequences, and one clone, VK17, gave an alternative VK sequence. The ten identical clones originated from three 5′ primers (different from the two that gave the aberrant sequence), one of which also produced VK17. The sequencing strategy that was employed is shown in FIG. 9.
  • The nucleic acid sequence of J591 VK corresponding to the ten identical clones (designated SEQ. ID. No. 9) is presented in FIG. 10, along with the nucleic acid sequence of the corresponding reverse, non-coding strand (designated SEQ. ID. No. 10) and the deduced amino acid sequences, which are designated SEQ. ID. No. 11, SEQ. ID. No. 12, and SEQ. ID. No. 13. These sequences include part of the signal sequence and part of the constant region of the antibody. The coding strand of the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to the ten identical clones has the following nucleotide sequence (designated SEQ. ID. No. 14): [0119]
    AACATTGTAATGACCCAATCTCCCAAATCCATGTCCATGTCAGTAGGAGAGAGGGTC
    ACCTTGACCTGCAAGGCCAGTGAGAATGTGGTTACTTATGTTTCCTGGTATCAACAG
    AAACCAGAGCAGTCTCCTAAACTGCTGATATACGGGGCATCCAACCGGTACACTGGG
    GTCCCCGATCGCTTCACAGGCAGTGGATCTGCAACAGATTTCACTCTGACCATCAGC
    AGTGTGCAGGCTGAAGACCTTGCAGATTATCACTGTGGACAGGGTTACAGCTATCCG
    TACACGTTCGGAGGGGGGACCAAGCTGGAAATAAAA
  • The reverse, non-coding strand of the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to the ten identical clones has the following nucleotide sequence (designated SEQ. ID. No. 15): [0120]
    TTTTATTTCCAGCTTGGTCCCCCCTCCGAACGTGTACGGATAGCTGTAACCCTGTCC
    ACAGTGATAATCTGCAAGGTCTTCAGCCTGCACACTGCTGATGGTCAGAGTGAAATC
    TGTTGCAGATCCACTGCCTGTGAAGCGATCGGGGACCCCAGTGTACCGGTTGGATGC
    CCCGTATATCAGCAGTTTAGGAGACTGCTCTGGTTTCTGTTGATACCAGGAAACATA
    AGTAACCACATTCTCACTGGCCTTGCAGGTCAAGGTGACCCTCTCTCCTACTGACAT
    GGACATGGATTTGGGAGATTGGGTCATTACAATGTT
  • The protein sequence corresponding to the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to the ten identical clones has the following nucleotide sequence (designated SEQ. ID. No. 16): [0121]
    NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTG
    VPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIK
  • The coding strand of the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to clone VK17 has the following nucleotide sequence (designated SEQ. ID. No. 17): [0122]
    GACATTGTGATGACCCAGTCTCACAAATTCATGTCCACATCAGTAGGAGACAGGGTC
    AGCATCATCTGTAAGGCCAGTCAAGATGTGGGTACTGCTGTAGACTGGTATCAACAG
    AAACCAGGACAATCTCCTAAACTACTGATTTATTGGGCATCCACTCGGCACACTGGA
    GTCCCTGATCGCTTCACAGGCAGTGGATCTGGGACAGACTTCACTCTCACCATTACT
    AATGTTCAGTCTGAAGACTTGGCAGATTATTTCTGTCAGCAATATAACAGCTATCCT
    CTCACGTTCGGTGCTGGGACCATGCTGGACCTGAAA
  • The reverse, non-coding strand of the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to clone VK17 has the following nucleotide sequence (designated SEQ. ID. No. 18): [0123]
    TTTCAGGTCCAGCATGGTCCCAGCACCGAACGTGAGAGGATAGCTGTTATATTGCTG
    ACAGAAATAATCTGCCAAGTCTTCAGACTGAACATTAGTAATGGTGAGAGTGAAGTC
    TGTCCCAGATCCACTGCCTGTGAAGCGATCAGGGACTCCAGTGTGCCGAGTGGATGC
    CCAATAAATCAGTAGTTTAGGAGATTGTCCTGGTTTCTGTTGATACCAGTCTACAGC
    AGTACCCACATCTTGACTGGCCTTACAGATGATGCTGACCCTGTCTCCTACTGATGT
    GGACATGAATTTGTGAGACTGGGTCATCACAATGTC
  • The protein sequence corresponding to the J591 light (kappa) chain's variable region (exclusive of signal sequence and constant region components) corresponding to clone VK17 has the following nucleotide sequence (designated SEQ. ID. No. 19): [0124]
    DIVMTQSHKFMSTSVGDRVSIICKASQDVGTAVDWYQQKPGQSPKLLIYWASTRHTG
    VPDRFTGSGSGTDFTLTITNVQSEDLADYFCQQYNSYPLTFGAGTMLDLK
  • J591 VK is in the Mouse Kappa Chains Subgroup V (Kabat, which is hereby incorporated by reference). The sequence of J591 VK corresponding to the ten identical clones is compared to the consensus sequence for the subgroup in FIG. 11. [0125]
  • Although the invention has been described in detail for the purpose of illustration, it is understood that such detail is solely for that purpose and variations can be made by those skilled in the art without departing from the spirit and scope of the invention which is defined by the following claims. [0126]
  • 1 21 1 391 DNA Mus sp. 1 tctcctgtca ggaactgcag gtgtcctctc tgaggtccag ctgcaacagt ctggacctga 60 actggtgaag cctgggactt cagtgaggat atcctgcaag acttctggat acacattcac 120 tgaatatacc atacactggg tgaagcagag ccatggaaag agccttgagt ggattggaaa 180 catcaatcct aacaatggtg gtaccaccta caatcagaag ttcgaggaca aggccacatt 240 gactgtagac aagtcctcca gtacagccta catggagctc cgcagcctaa catctgagga 300 ttctgcagtc tattattgtg cagctggttg gaactttgac tactggggcc aaggcaccac 360 tctcacagtc tcctcagcca aaacgacacc c 391 2 391 DNA Mus sp. 2 gggtgtcgtt ttggctgagg agactgtgag agtggtgcct tggccccagt agtcaaagtt 60 ccaaccagct gcacaataat agactgcaga atcctcagat gttaggctgc ggagctccat 120 gtaggctgta ctggaggact tgtctacagt caatgtggcc ttgtcctcga acttctgatt 180 gtaggtggta ccaccattgt taggattgat gtttccaatc cactcaaggc tctttccatg 240 gctctgcttc acccagtgta tggtatattc agtgaatgtg tatccagaag tcttgcagga 300 tatcctcact gaagtcccag gcttcaccag ttcaggtcca gactgttgca gctggacctc 360 agagaggaca cctgcagttc ctagcaggag a 391 3 123 PRT Mus sp. 3 Ser Pro Val Arg Asn Cys Arg Cys Pro Leu Gly Pro Ala Ala Thr Val 1 5 10 15 Trp Thr Thr Gly Glu Ala Trp Asp Phe Ser Glu Asp Ile Leu Gln Asp 20 25 30 Phe Trp Ile His Ile His Ile Tyr His Thr Leu Gly Glu Ala Glu Pro 35 40 45 Trp Lys Glu Pro Val Asp Trp Lys His Gln Ser Gln Trp Trp Tyr His 50 55 60 Leu Gln Ser Glu Val Arg Gly Gln Gly His Ile Asp Cys Arg Gln Val 65 70 75 80 Leu Gln Tyr Ser Leu His Gly Ala Pro Gln Pro Asn Ile Gly Phe Cys 85 90 95 Ser Leu Leu Leu Cys Ser Trp Leu Glu Leu Leu Leu Gly Pro Arg His 100 105 110 His Ser His Ser Leu Leu Ser Gln Asn Asp Thr 115 120 4 130 PRT Mus sp. 4 Leu Leu Ser Gly Thr Ala Gly Val Leu Ser Glu Val Gln Leu Gln Gln 1 5 10 15 Ser Gly Pro Glu Leu Val Lys Pro Gly Thr Ser Val Arg Ile Ser Cys 20 25 30 Lys Thr Ser Gly Tyr Thr Phe Thr Glu Tyr Thr Ile His Trp Val Lys 35 40 45 Gln Ser His Gly Lys Ser Leu Glu Trp Ile Gly Asn Ile Asn Pro Asn 50 55 60 Asn Gly Gly Thr Thr Tyr Asn Gln Lys Phe Glu Asp Lys Ala Thr Leu 65 70 75 80 Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu 85 90 95 Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys Ala Ala Gly Trp Asn Phe 100 105 110 Asp Tyr Trp Gly Gln Gly Thr Thr Leu Thr Val Ser Ser Ala Lys Thr 115 120 125 Thr Pro 130 5 125 PRT Mus sp. 5 Leu Ser Cys Gln Glu Leu Gln Val Ser Ser Leu Arg Ser Ser Cys Asn 1 5 10 15 Ser Leu Asp Leu Asn Trp Ser Leu Gly Leu Gln Gly Tyr Pro Ala Arg 20 25 30 Leu Leu Asp Thr His Ser Leu Asn Ile Pro Tyr Thr Gly Ser Arg Ala 35 40 45 Met Glu Arg Ala Leu Ser Gly Leu Glu Thr Ser Ile Leu Thr Met Val 50 55 60 Val Pro Pro Thr Ile Arg Ser Ser Arg Thr Arg Pro His Leu Thr Ser 65 70 75 80 Pro Pro Val Gln Pro Thr Trp Ser Ser Ala Ala His Leu Arg Ile Leu 85 90 95 Gln Ser Ile Ile Val Gln Leu Val Gly Thr Leu Thr Thr Gly Ala Lys 100 105 110 Ala Pro Leu Ser Gln Pro Ser Gln Pro Lys Arg His Pro 115 120 125 6 345 DNA Mus sp. 6 gaggtccagc tgcaacagtc tggacctgaa ctggtgaagc ctgggacttc agtgaggata 60 tcctgcaaga cttctggata cacattcact gaatatacca tacactgggt gaagcagagc 120 catggaaaga gccttgagtg gattggaaac atcaatccta acaatggtgg taccacctac 180 aatcagaagt tcgaggacaa ggccacattg actgtagaca agtcctccag tacagcctac 240 atggagctcc gcagcctaac atctgaggat tctgcagtct attattgtgc agctggttgg 300 aactttgact actggggcca aggcaccact ctcacagtct cctca 345 7 345 DNA Mus sp. 7 tgaggagact gtgagagtgg tgccttggcc ccagtagtca aagttccaac cagctgcaca 60 ataatagact gcagaatcct cagatgttag gctgcggagc tccatgtagg ctgtactgga 120 ggacttgtct acagtcaatg tggccttgtc ctcgaacttc tgattgtagg tggtaccacc 180 attgttagga ttgatgtttc caatccactc aaggctcttt ccatggctct gcttcaccca 240 gtgtatggta tattcagtga atgtgtatcc agaagtcttg caggatatcc tcactgaagt 300 cccaggcttc accagttcag gtccagactg ttgcagctgg acctc 345 8 115 PRT Mus sp. 8 Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Thr 1 5 10 15 Ser Val Arg Ile Ser Cys Lys Thr Ser Gly Tyr Thr Phe Thr Glu Tyr 20 25 30 Thr Ile His Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40 45 Gly Asn Ile Asn Pro Asn Asn Gly Gly Thr Thr Tyr Asn Gln Lys Phe 50 55 60 Glu Asp Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala Tyr 65 70 75 80 Met Glu Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95 Ala Ala Gly Trp Asn Phe Asp Tyr Trp Gly Gln Gly Thr Thr Leu Thr 100 105 110 Val Ser Ser 115 9 363 DNA Mus sp. 9 ttatatggag ctgatgggaa cattgtaatg acccaatctc ccaaatccat gtccatgtca 60 gtaggagaga gggtcacctt gacctgcaag gccagtgaga atgtggttac ttatgtttcc 120 tggtatcaac agaaaccaga gcagtctcct aaactgctga tatacggggc atccaaccgg 180 tacactgggg tccccgatcg cttcacaggc agtggatctg caacagattt cactctgacc 240 atcagcagtg tgcaggctga agaccttgca gattatcact gtggacaggg ttacagctat 300 ccgtacacgt tcggaggggg gaccaagctg gaaataaaac gggctgatgc tgcaccaact 360 gta 363 10 363 DNA Mus sp. 10 tacagttggt gcagcatcag cccgttttat ttccagcttg gtcccccctc cgaacgtgta 60 cggatagctg taaccctgtc cacagtgata atctgcaagg tcttcagcct gcacactgct 120 gatggtcaga gtgaaatctg ttgcagatcc actgcctgtg aagcgatcgg ggaccccagt 180 gtaccggttg gatgccccgt atatcagcag tttaggagac tgctctggtt tctgttgata 240 ccaggaaaca taagtaacca cattctcact ggccttgcag gtcaaggtga ccctctctcc 300 tactgacatg gacatggatt tgggagattg ggtcattaca atgttcccat cagctccata 360 taa 363 11 121 PRT Mus sp. 11 Leu Tyr Gly Ala Asp Gly Asn Ile Val Met Thr Gln Ser Pro Lys Ser 1 5 10 15 Met Ser Met Ser Val Gly Glu Arg Val Thr Leu Thr Cys Lys Ala Ser 20 25 30 Glu Asn Val Val Thr Tyr Val Ser Trp Tyr Gln Gln Lys Pro Glu Gln 35 40 45 Ser Pro Lys Leu Leu Ile Tyr Gly Ala Ser Asn Arg Tyr Thr Gly Val 50 55 60 Pro Asp Arg Phe Thr Gly Ser Gly Ser Ala Thr Asp Phe Thr Leu Thr 65 70 75 80 Ile Ser Ser Val Gln Ala Glu Asp Leu Ala Asp Tyr His Cys Gly Gln 85 90 95 Gly Tyr Ser Tyr Pro Tyr Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile 100 105 110 Lys Arg Ala Asp Ala Ala Pro Thr Val 115 120 12 114 PRT Mus sp. 12 Tyr Met Glu Leu Met Gly Thr Leu Pro Asn Leu Pro Asn Pro Cys Pro 1 5 10 15 Cys Gln Glu Arg Gly Ser Pro Pro Ala Arg Pro Val Arg Met Trp Leu 20 25 30 Leu Met Phe Pro Gly Ile Asn Arg Asn Gln Ser Ser Leu Leu Asn Cys 35 40 45 Tyr Thr Gly His Pro Thr Gly Thr Leu Gly Ser Pro Ile Ala Ser Gln 50 55 60 Ala Val Asp Leu Gln Gln Ile Ser Leu Pro Ser Ala Val Cys Arg Leu 65 70 75 80 Lys Thr Leu Gln Ile Ile Thr Val Asp Arg Val Thr Ala Ile Arg Thr 85 90 95 Arg Ser Glu Gly Gly Pro Ser Trp Lys Asn Gly Leu Met Leu His Gln 100 105 110 Leu Tyr 13 116 PRT Mus sp. 13 Ile Ile Trp Ser Trp Glu His Cys Asn Asp Pro Ile Ser Gln Ile His 1 5 10 15 Val His Val Ser Arg Arg Glu Gly His Leu Asp Leu Gln Gly Gln Glu 20 25 30 Cys Gly Tyr Leu Cys Phe Leu Val Ser Thr Glu Thr Arg Ala Val Ser 35 40 45 Thr Ala Asp Ile Arg Gly Ile Gln Pro Val His Trp Gly Pro Arg Ser 50 55 60 Leu His Arg Gln Trp Ile Cys Asn Arg Phe His Ser Asp His Gln Gln 65 70 75 80 Cys Ala Gly Arg Pro Cys Arg Leu Ser Leu Trp Thr Gly Leu Gln Leu 85 90 95 Ser Val His Val Arg Arg Gly Asp Gln Ala Gly Asn Lys Thr Gly Cys 100 105 110 Cys Thr Asn Cys 115 14 321 DNA Mus sp. 14 aacattgtaa tgacccaatc tcccaaatcc atgtccatgt cagtaggaga gagggtcacc 60 ttgacctgca aggccagtga gaatgtggtt acttatgttt cctggtatca acagaaacca 120 gagcagtctc ctaaactgct gatatacggg gcatccaacc ggtacactgg ggtccccgat 180 cgcttcacag gcagtggatc tgcaacagat ttcactctga ccatcagcag tgtgcaggct 240 gaagaccttg cagattatca ctgtggacag ggttacagct atccgtacac gttcggaggg 300 gggaccaagc tggaaataaa a 321 15 321 DNA Mus sp. 15 ttttatttcc agcttggtcc cccctccgaa cgtgtacgga tagctgtaac cctgtccaca 60 gtgataatct gcaaggtctt cagcctgcac actgctgatg gtcagagtga aatctgttgc 120 agatccactg cctgtgaagc gatcggggac cccagtgtac cggttggatg ccccgtatat 180 cagcagttta ggagactgct ctggtttctg ttgataccag gaaacataag taaccacatt 240 ctcactggcc ttgcaggtca aggtgaccct ctctcctact gacatggaca tggatttggg 300 agattgggtc attacaatgt t 321 16 107 PRT Mus sp. 16 Asn Ile Val Met Thr Gln Ser Pro Lys Ser Met Ser Met Ser Val Gly 1 5 10 15 Glu Arg Val Thr Leu Thr Cys Lys Ala Ser Glu Asn Val Val Thr Tyr 20 25 30 Val Ser Trp Tyr Gln Gln Lys Pro Glu Gln Ser Pro Lys Leu Leu Ile 35 40 45 Tyr Gly Ala Ser Asn Arg Tyr Thr Gly Val Pro Asp Arg Phe Thr Gly 50 55 60 Ser Gly Ser Ala Thr Asp Phe Thr Leu Thr Ile Ser Ser Val Gln Ala 65 70 75 80 Glu Asp Leu Ala Asp Tyr His Cys Gly Gln Gly Tyr Ser Tyr Pro Tyr 85 90 95 Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 105 17 321 DNA Mus sp. 17 gacattgtga tgacccagtc tcacaaattc atgtccacat cagtaggaga cagggtcagc 60 atcatctgta aggccagtca agatgtgggt actgctgtag actggtatca acagaaacca 120 ggacaatctc ctaaactact gatttattgg gcatccactc ggcacactgg agtccctgat 180 cgcttcacag gcagtggatc tgggacagac ttcactctca ccattactaa tgttcagtct 240 gaagacttgg cagattattt ctgtcagcaa tataacagct atcctctcac gttcggtgct 300 gggaccatgc tggacctgaa a 321 18 321 DNA Mus sp. 18 tttcaggtcc agcatggtcc cagcaccgaa cgtgagagga tagctgttat attgctgaca 60 gaaataatct gccaagtctt cagactgaac attagtaatg gtgagagtga agtctgtccc 120 agatccactg cctgtgaagc gatcagggac tccagtgtgc cgagtggatg cccaataaat 180 cagtagttta ggagattgtc ctggtttctg ttgataccag tctacagcag tacccacatc 240 ttgactggcc ttacagatga tgctgaccct gtctcctact gatgtggaca tgaatttgtg 300 agactgggtc atcacaatgt c 321 19 107 PRT Mus sp. 19 Asp Ile Val Met Thr Gln Ser His Lys Phe Met Ser Thr Ser Val Gly 1 5 10 15 Asp Arg Val Ser Ile Ile Cys Lys Ala Ser Gln Asp Val Gly Thr Ala 20 25 30 Val Asp Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Lys Leu Leu Ile 35 40 45 Tyr Trp Ala Ser Thr Arg His Thr Gly Val Pro Asp Arg Phe Thr Gly 50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Thr Asn Val Gln Ser 65 70 75 80 Glu Asp Leu Ala Asp Tyr Phe Cys Gln Gln Tyr Asn Ser Tyr Pro Leu 85 90 95 Thr Phe Gly Ala Gly Thr Met Leu Asp Leu Lys 100 105 20 125 PRT Mus sp. 20 Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30 Tyr Met Asn Asn Trp Val Lys Gln Ser Pro Gly Lys Ser Leu Glu Trp 35 40 45 Ile Gly Asp Ile Asn Pro Gly Asn Gly Gly Thr Ser Tyr Asn Gln Lys 50 55 60 Phe Lys Gly Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Ser Thr Ala 65 70 75 80 Tyr Met Gln Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr 85 90 95 Cys Ala Arg Gly Tyr Tyr Ser Ser Ser Tyr Met Ala Tyr Tyr Ala Phe 100 105 110 Asp Tyr Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser 115 120 125 21 109 PRT Mus sp. 21 Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Leu Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Asp Ile Ser Asn 20 25 30 Tyr Leu Asn Trp Tyr Gln Gln Lys Pro Gly Gly Ser Pro Lys Leu Leu 35 40 45 Ile Tyr Tyr Ala Ser Arg Leu His Ser Gly Val Pro Ser Arg Phe Ser 50 55 60 Gly Ser Gly Ser Gly Thr Asp Tyr Ser Leu Thr Ile Ser Asn Leu Glu 65 70 75 80 Gln Glu Asp Ile Ala Thr Tyr Phe Cys Gln Gln Gly Asn Thr Leu Pro 85 90 95 Pro Arg Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 105

Claims (67)

What is claimed:
1. A method of ablating or killing normal, benign hyperplastic, and cancerous prostate epithelial cells comprising:
providing a biological agent which binds to an extracellular domain of prostate specific membrane antigen and
contacting said cells with the biological agent under conditions effective to permit both binding of the biological agent to the extracellular domain of the prostate specific membrane antigen and ablating or killing of said cells.
2. A method according to claim 1, wherein the biological agent is an antibody or binding portion thereof, probe, or ligand.
3. A method according to claim 1, wherein the biological agent is internalized with the prostate specific membrane antigen.
4. A method according to claim 1, wherein said contacting is carried out in a living mammal and comprises:
administering the biological agent to the mammal under conditions effective to permit both binding of the biological agent to the extracellular domain of the prostate specific membrane antigen and killing of said cells.
5. A method according to claim 4, wherein the biological agent is internalized with the prostate specific membrane antigen.
6. A method according to claim 4, wherein said administering is carried out orally, parenterally, subcutaneously, intravenously, intramuscularly, intraperitoneally, by intranasal instillation, by intracavitory or intravesical instillation, intraocularly, intraarterially, intralesionally, or by application to mucous membranes.
7. A method according to claim 2, wherein an antibody is used in carrying out said method, the antibody being selected from the group consisting of a monoclonal antibody and a polyclonal antibody.
8. A method according to claim 7, wherein the antibody is selected from the group consisting of an E99, a J415, a J533, and a J591 monoclonal antibody.
9. A method according to claim 7, wherein the antibody is a monoclonal antibody produced by a hybridoma cell line having an ATCC Accession Number selected from the group consisting of HB-12101, HB-12109, HB-12127, and HB-12126.
10. A method according to claim 2, wherein a binding portion of an antibody is used in carrying out said method, the binding portion being selected from the group consisting of an Fab fragment, an F(ab′)2 fragment, and an Fv fragment.
11. A method according to claim 2, wherein the probe or ligand is used in carrying out said method.
12. A method according to claim 1, wherein the biological agent is bound to a substance effective to kill or ablate said cells upon binding of the biological agent to the extracellular domain of the prostate specific membrane antigen of said cells.
13. A method according to claim 12, wherein the substance effective to kill said cells is a cytotoxic drug.
14. A method according to claim 13, wherein the cytotoxic drug is selected from the group consisting of therapeutic drug, a compound emitting radiation, molecules of plant, fungal, or bacterial origin, biological proteins, and mixtures thereof.
15. A method according to claim 2, wherein the antibody is effective to initiate an endogenous host immune function.
16. A method according to claim 15, wherein the endogenous host immune function is complement-mediated cellular cytoxicity.
17. A method according to claim 15, wherein the endogenous host immune function is antibody-dependent cellular cytoxicity.
18. A method according to claim 1, wherein the biological agent is in a composition further comprising a physiologically acceptable carrier, excipient, or stabilizer.
19. A method according to claim 1, wherein the biological agent is in a composition further comprising a pharmaceutically acceptable carrier, excipient, or stabilizer.
20. A method according to claim 1 further comprising:
providing a second biological agent which binds to the extracellular domain of prostate specific membrane antigen and
contacting said cells with the second biological agent under conditions effective to permit binding of the second biological agent to the extracellular domain of the prostate specific membrane antigen.
21. A method according to claim 20, wherein the biological agent and the second biological agent bind to non-competing binding sites on the extracellular domain of the prostate specific membrane antigen.
22. A method according to claim 20, wherein the biological agent is a J415 monoclonal antibody and the second biological agent is an E99, a J533, or a J591 monoclonal antibody.
23. A method according to claim 20, wherein the biological agent is bound to a substance effective to kill or ablate said cells upon binding of the biological agent to the extracellular domain of the prostate specific membrane antigen of said cells and upon activation by an activator and wherein the second biological agent is bound to the activator.
24. A method of detecting normal, benign hyperplastic, and cancerous prostate epithelial cells or a portion thereof in a biological sample comprising:
providing an biological agent which binds to an extracellular domain of prostate specific membrane antigen, wherein the biological agent is bound to a label effective to permit detection of said cells or a portion thereof upon binding of the biological agent to said cells or a portion thereof;
contacting the biological sample with the biological agent having a label under conditions effective to permit binding of the biological agent to the extracellular domain of the prostate specific membrane antigen of any of said cells or a portion thereof in the biological sample; and
detecting a presence of any of said cells or a portion thereof in the biological sample by detecting the label.
25. A method according to claim 24, wherein the biological agent is an antibody or binding portion thereof, probe, or ligand.
26. A method according to claim 24, wherein the biological agent is internalized with the prostate specific membrane antigen.
27. A method according to claim 24, wherein said contacting is carried out in a living mammal and comprises:
administering the biological agent to the mammal under conditions effective to permit binding of the biological agent to the extracellular domain of the prostate specific membrane antigen of any of said cells or a portion thereof in the biological sample.
28. A method according to claim 27, wherein the label is a short-range radiation emitter.
29. A method according to claim 27, wherein said detecting is carried out rectally.
30. A method according to claim 27, wherein the biological sample is the mammal's prostatic fossa.
31. A method according to claim 27, wherein said detecting is carried out after a prostatectomy.
32. A method according to claim 27, wherein the biological agent is internalized with the prostate specific membrane antigen.
33. A method according to claim 27, wherein said administering is carried out orally, parenterally, subcutaneously, intravenously, intramuscularly, intraperitoneally, by intraversal instillation, by intracavitory or intravesical instillation, intraocularly, intraarterially, intralesionally, or by application to mucous membranes.
34. A method according to claim 25, wherein an antibody is used in carrying out said method, said antibody being selected from the group consisting of a monoclonal antibody and a polyclonal antibody.
35. A method according to claim 34, wherein the antibody is selected from the group consisting of an E99, a J415, a J533, and a J591 monoclonal antibody.
36. A method according to claim 34, wherein the antibody is a monoclonal antibody produced by a hybridoma cell line having an ATCC Accession Number selected from the group consisting of HB-12101, HB-12109, HB-12127, and HB-12126.
37. A method according to claim 25, wherein a binding portion of an antibody is used in carrying out said method, the binding portion being selected from the group consisting of an Fab fragment, an F(ab′)2 fragment, and an Fv fragment.
38. A method according to claim 25, wherein a probe or ligand is used in carrying out said method.
39. A method according to claim 24, wherein the label is selected from the group consisting of a fluorescent label, a radioactive label, a nuclear magnetic resonance active label, a luminescent label, and a chromophore label.
40. A method according to claim 24, wherein the biological agent is in a composition further comprising a physiologically acceptable carrier, excipient, or stabilizer.
41. A method according to claim 24, wherein the biological agent is in a composition further comprising a pharmaceutically acceptable carrier, excipient, or stabilizer.
42. A method according to claim 24, wherein said contacting is carried out in a sample of serum or urine.
43. An isolated biological agent which binds to an extracellular domain of prostate specific membrane antigen.
44. An isolated biological agent according to claim 43, wherein said isolated biological agent is an isolated antibody or binding portion thereof, probe, or ligand.
45. An isolated biological agent according to claim 43, wherein the biological agent is internalized with the prostate specific membrane antigen.
46. An isolated biological agent according to claim 44, wherein the isolated biological agent is an antibody selected from the group consisting of a monoclonal antibody and a polyclonal antibody.
47. An isolated biological agent according to claim 46, wherein the antibody is selected from the group consisting of an E99, a J415, a J533, and a J591 monoclonal antibody.
48. An isolated biological agent according to claim 46, wherein the antibody is a monoclonal antibody produced by a hybridoma having an ATCC Accession Number selected from the group consisting of HB-12101, HB-12109, HB-12127, and HB-12126.
49. An isolated biological agent according to claim 44, wherein the isolated biological agent is a binding portion of an antibody selected from the group consisting of a Fab fragment, a F(ab′)2 fragment, and a Fv fragment.
50. An isolated biological agent according to claim 44, wherein the isolated biological agent is a probe or ligand.
51. An isolated biological agent according to claim 43, wherein the biological agent is bound to a cytotoxic drug.
52. An isolated biological agent according to claim 51, wherein the cytotoxic drug is selected from the group consisting of a therapeutic drug, a compound emitting radiation, molecules of plant, fungal, or bacterial origin, biological proteins, and mixtures thereof.
53. A composition comprising:
a biological agent according to claim 51 and
a physiologically acceptable carrier, excipient, or stabilizer mixed with the biological agent.
54. A composition comprising:
a biological agent according to claim 51 and
a pharmaceutically acceptable carrier, excipient, or stabilizer mixed with the biological agent.
55. An isolated biological agent according to claim 43, wherein said biological agent is bound to a label.
56. An isolated biological agent according to claim 55, wherein the label is selected from the group consisting of a fluorescent label, a biologically-active enzyme label, a radioactive label, a nuclear magnetic resonance active label, a luminescent label, and a chromophore label.
57. A composition comprising:
a biological agent according to claim 55 and
a physiologically acceptable carrier, excipient, or stabilizer mixed with the biological agent.
58. A composition comprising:
a biological agent according to claim 55 and
a pharmaceutically acceptable carrier, excipient, or stabilizer mixed with the biological agent.
59. A kit for detecting prostate cancer comprising:
a biological agent according to claim 55 and means to detect the label.
60. A kit according to claim 59, wherein the label is selected from the group consisting of a fluorescent label, a biologically-active enzyme label, a radioactive label, a nuclear magnetic resonance active label, a luminescent label, and a chromophore label.
61. A kit according to claim 59, wherein said biological agent is an E99, a J415, a J533, or a J591 monoclonal antibody.
62. A kit according to claim 59, wherein the biological agent is in a composition further comprising a physiologically acceptable carrier, excipient, or stabilizer.
63. A kit according to claim 59, wherein the biological agent is in a composition further comprising a pharmaceutically acceptable carrier, excipient, or stabilizer.
64. A hybridoma cell line that produces a monoclonal antibody which binds to an extracellular domain of prostate specific membrane antigen.
65. A hybridoma cell according to claim 64, wherein the antibody is internalized with the prostate specific membrane antigen.
66. A hybridoma cell line according to claim 64, wherein the monoclonal antibody is an E99, a J415, a J533, or a J591 monoclonal antibody.
67. A hybridoma cell line according to claim 64 wherein the hybridoma cell line has an ATCC Accession Number selected from the group consisting of HB-12101, HB-12109, HB-12127, and HB-12126.
US09/929,665 1996-05-06 2001-08-13 Treatment and diagnosis of prostate cancer Abandoned US20030003101A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US09/929,665 US20030003101A1 (en) 1996-05-06 2001-08-13 Treatment and diagnosis of prostate cancer

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
US1697696P 1996-05-06 1996-05-06
US2212596P 1996-07-18 1996-07-18
US08/838,682 US6107090A (en) 1996-05-06 1997-04-09 Treatment and diagnosis of prostate cancer with antibodies to extracellur PSMA domains
US09/357,704 US7666425B1 (en) 1996-05-06 1999-07-20 Treatment and diagnosis of prostate cancer
US09/929,665 US20030003101A1 (en) 1996-05-06 2001-08-13 Treatment and diagnosis of prostate cancer

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US09/357,704 Continuation US7666425B1 (en) 1996-05-06 1999-07-20 Treatment and diagnosis of prostate cancer

Publications (1)

Publication Number Publication Date
US20030003101A1 true US20030003101A1 (en) 2003-01-02

Family

ID=26695548

Family Applications (4)

Application Number Title Priority Date Filing Date
US08/838,682 Expired - Lifetime US6107090A (en) 1996-05-06 1997-04-09 Treatment and diagnosis of prostate cancer with antibodies to extracellur PSMA domains
US09/357,704 Expired - Fee Related US7666425B1 (en) 1996-05-06 1999-07-20 Treatment and diagnosis of prostate cancer
US09/357,709 Expired - Fee Related US7112412B1 (en) 1996-05-06 1999-07-20 Treatment and diagnosis of prostate cancer
US09/929,665 Abandoned US20030003101A1 (en) 1996-05-06 2001-08-13 Treatment and diagnosis of prostate cancer

Family Applications Before (3)

Application Number Title Priority Date Filing Date
US08/838,682 Expired - Lifetime US6107090A (en) 1996-05-06 1997-04-09 Treatment and diagnosis of prostate cancer with antibodies to extracellur PSMA domains
US09/357,704 Expired - Fee Related US7666425B1 (en) 1996-05-06 1999-07-20 Treatment and diagnosis of prostate cancer
US09/357,709 Expired - Fee Related US7112412B1 (en) 1996-05-06 1999-07-20 Treatment and diagnosis of prostate cancer

Country Status (16)

Country Link
US (4) US6107090A (en)
EP (2) EP0956506B1 (en)
JP (2) JP4503102B2 (en)
CN (2) CN1165764C (en)
AT (1) ATE319089T1 (en)
AU (1) AU733544C (en)
BR (1) BR9710487A (en)
CA (1) CA2261018C (en)
DE (1) DE69735368T2 (en)
EA (2) EA004634B1 (en)
ES (1) ES2255723T3 (en)
HK (1) HK1025631A1 (en)
IL (2) IL127979A0 (en)
NZ (2) NZ333683A (en)
PT (1) PT956506E (en)
WO (1) WO1998003873A1 (en)

Cited By (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040001846A1 (en) * 1995-02-24 2004-01-01 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen and uses thereof
US20040033229A1 (en) * 2001-10-23 2004-02-19 Maddon Paul J. PSMA antibodies and protein multimers
US20040120958A1 (en) * 2001-06-01 2004-06-24 Bander Neil H. Modified antibodies to prostate-specific membrane antigen and uses thereof
US6953668B1 (en) 1992-11-05 2005-10-11 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen
US20060062793A1 (en) * 2004-03-03 2006-03-23 Webb Iain J Modified antibodies to prostate-specific membrane antigen and uses thereof
US7045605B2 (en) 2001-06-01 2006-05-16 Cornell Research Foundation, Inc. Modified antibodies to prostate-specific membrane antigen and uses thereof
US7070782B1 (en) 1992-11-05 2006-07-04 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen
US20090060908A1 (en) * 2005-02-18 2009-03-05 Medarex, Inc. Monoclonal Antibodies Against Prostate Specific Membrane Antigen (PSMA) Lacking in Fucosyl Residues
US20090297438A1 (en) * 2005-02-18 2009-12-03 Haichun Huang Human Monoclonal Antibodies to Prostate Specific Membrane Antigen (PSMA)
US20100150950A1 (en) * 2006-12-14 2010-06-17 Medarex, Inc. Human antibodies that bind cd70 and uses thereof
US20100278726A1 (en) * 2001-06-01 2010-11-04 Cornell Research Foundation, Inc. Modified Antibodies to Prostate-Specific Membrane Antigen and Uses Thereof
US20110165081A1 (en) * 2001-10-23 2011-07-07 Psma Development Company, Llc Psma antibodies and uses thereof
US8124738B2 (en) 2005-09-26 2012-02-28 Medarex, Inc. Human monoclonal antibodies to CD70
USRE43586E1 (en) 1992-11-05 2012-08-14 Sloan-Kettering Institute For Cancer Research Antibodies to prostate-specific membrane antigen
US9242012B2 (en) 2008-09-08 2016-01-26 Psma Development Company, Llc Methods for killing PSMA-expressing, taxane-resistant cancer cells
US20170138543A1 (en) * 2011-02-22 2017-05-18 Quarkstar Llc Solid State Lamp Using Light Emitting Strips
USD990174S1 (en) 2019-03-01 2023-06-27 Simplehuman, Llc Vanity mirror

Families Citing this family (125)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6749853B1 (en) 1992-03-05 2004-06-15 Board Of Regents, The University Of Texas System Combined methods and compositions for coagulation and tumor treatment
US5965132A (en) 1992-03-05 1999-10-12 Board Of Regents, The University Of Texas System Methods and compositions for targeting the vasculature of solid tumors
CA2212846A1 (en) 1995-02-24 1996-08-29 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen and uses thereof
US20040253246A1 (en) * 1996-02-23 2004-12-16 Israeli Ron S. Prostate-specific membrane antigen and uses thereof
US6962981B1 (en) * 1996-03-25 2005-11-08 Medarex, Inc. Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen
US6150508A (en) * 1996-03-25 2000-11-21 Northwest Biotherapeutics, Inc. Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen
US7381407B1 (en) * 1996-03-25 2008-06-03 Medarex, Inc. Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen
US6136311A (en) 1996-05-06 2000-10-24 Cornell Research Foundation, Inc. Treatment and diagnosis of cancer
US20060024301A1 (en) * 1997-02-25 2006-02-02 Corixa Corporation Prostate-specific polypeptides and fusion polypeptides thereof
US6759515B1 (en) * 1997-02-25 2004-07-06 Corixa Corporation Compositions and methods for the therapy and diagnosis of prostate cancer
US20060269532A1 (en) * 1997-02-25 2006-11-30 Corixa Corporation Compositions and methods for the therapy and diagnosis of prostate cancer
US6207805B1 (en) * 1997-07-18 2001-03-27 University Of Iowa Research Foundation Prostate cell surface antigen-specific antibodies
US6232287B1 (en) * 1998-03-13 2001-05-15 The Burnham Institute Molecules that home to various selected organs or tissues
US6200765B1 (en) 1998-05-04 2001-03-13 Pacific Northwest Cancer Foundation Non-invasive methods to detect prostate cancer
FR2791573B1 (en) * 1999-03-30 2003-04-11 Pf Medicament USE OF A SERENOA REPENS EXTRACT FOR THE MANUFACTURE OF A MEDICAMENT FOR THE TREATMENT OF PROSTATE CANCER
EP1210374B1 (en) * 1999-07-29 2006-10-11 Medarex, Inc. Human monoclonal antibodies to prostate specific membrane antigen
EP1710256A1 (en) * 1999-07-29 2006-10-11 Medarex, Inc. Human monoclonal antibodies to prostate specific membrane antigen
AU7351800A (en) * 1999-09-13 2001-04-17 Neil H. Bander A method for isolation of prostatic epithelial cells from semen
US20080153119A1 (en) * 1999-09-24 2008-06-26 Schebo Biotech Ag Detecting the presence of pyruvate kinase isoenzyme in feces
IL151128A0 (en) 2000-02-08 2003-04-10 Rice University Optically-active nanoparticles for use in therapeutic and diagnostic methods
US6379550B1 (en) * 2000-07-24 2002-04-30 Health Research, Inc. Method for detecting PSA and its molecular forms using thiophilic gel
US7048931B1 (en) 2000-11-09 2006-05-23 Corixa Corporation Compositions and methods for the therapy and diagnosis of prostate cancer
AU2002239403A1 (en) * 2000-12-01 2002-06-11 The Johns Hopkins University Tissue specific prodrugs
EP1390069A1 (en) * 2001-05-30 2004-02-25 Cornell Research Foundation, Inc. Endopeptidase/anti-psma antibody fusion proteins for treatment of cancer
US20060073530A1 (en) * 2001-08-15 2006-04-06 Olaf Schneewind Methods and compositions involving sortase B
AU2002359244A1 (en) * 2001-09-05 2003-04-28 The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Imaging the activity of extracellular proteases in cells using mutant anthrax toxin protective antigens that are cleaved by specific extracellular proteases
WO2003024388A2 (en) 2001-09-20 2003-03-27 Cornell Research Foundation, Inc. Methods and compositions for treating and preventing skin disorders using binding agents specific for psma
US20030129193A1 (en) * 2001-09-27 2003-07-10 Board Of Regents, The University Of Texas System And Peregrine Pharmaceuticals, Inc. Combined methods for tumor vasculature coaguligand treatment
US20040161776A1 (en) * 2001-10-23 2004-08-19 Maddon Paul J. PSMA formulations and uses thereof
US7591994B2 (en) 2002-12-13 2009-09-22 Immunomedics, Inc. Camptothecin-binding moiety conjugates
US7767803B2 (en) * 2002-06-18 2010-08-03 Archemix Corp. Stabilized aptamers to PSMA and their use as prostate cancer therapeutics
EP1537146B9 (en) 2002-07-15 2011-07-06 Board Of Regents, The University Of Texas System Antibodies binding to anionic phospholipids and aminophospholipids and their use in treating viral infections
US7390898B2 (en) 2002-08-02 2008-06-24 Immunogen Inc. Cytotoxic agents containing novel potent taxanes and their therapeutic use
ATE408712T1 (en) * 2003-01-10 2008-10-15 Millennium Pharm Inc METHOD FOR DETERMINING RECURRENCE OF PROSTATE CANCER
US7811564B2 (en) * 2003-01-28 2010-10-12 Proscan Rx Pharma Prostate cancer diagnosis and treatment
US20080241262A1 (en) * 2004-03-29 2008-10-02 The University Of Houston System Nanoshells and Discrete Polymer-Coated Nanoshells, Methods For Making and Using Same
WO2005100404A1 (en) * 2004-04-19 2005-10-27 Proscan Rx Pharma Prostate cancer diagnosis and treatment
EP1819277A4 (en) * 2004-11-12 2010-05-05 Ltd Kpe Nanoparticle mediated ultrasound therapy and diagnostic imaging
WO2006086345A2 (en) * 2005-02-07 2006-08-17 The Trustees Of Columbia University In The City Of New York Methods to treat or prevent hormone-resistant prostate cancer using sirna specific for protocadherin-pc, or other inhibitors of protocadherin-pc expression or activity
JP2008536485A (en) * 2005-03-07 2008-09-11 アーケミックス コーポレイション Stabilized aptamers for PSMA and their use as prostate cancer therapeutics
EP1726650A1 (en) 2005-05-27 2006-11-29 Universitätsklinikum Freiburg Monoclonal antibodies and single chain antibody fragments against cell-surface prostate specific membrane antigen
US7736647B2 (en) * 2005-06-15 2010-06-15 Monoclonal Antibodies Therapeutics Anti-CD71 monoclonal antibodies and uses thereof for treating malignant tumor cells
NZ565075A (en) * 2005-06-20 2011-05-27 Psma Dev Company Llc PSMA antibody-drug conjugates
RU2456298C2 (en) * 2005-12-20 2012-07-20 ЭсБиАй БАЙОТЕК КО., ЛТД. Ilt17 antibody
EP2044122B1 (en) * 2006-07-18 2018-03-28 Sanofi Antagonist antibody against epha2 for the treatment of cancer
WO2009015263A2 (en) * 2007-07-25 2009-01-29 Wyeth Methods for characterizing cell proximity
EP2740490A1 (en) * 2007-10-03 2014-06-11 Cornell University Treatment of proliferative disorders using antibodies to PSMA
CN101861278B (en) 2007-11-14 2013-10-09 因温特奥股份公司 Lift drive and method for driving and detaining a lift car, a corresponding method and a braking device, and method for decelerating and detaining a lift car, and an associated method
EP2281004A4 (en) * 2008-04-14 2012-02-15 Proscan Rx Pharma Inc Prostate specific membrane antigen antibodies and antigen binding fragments
US20100082438A1 (en) * 2008-10-01 2010-04-01 Ronnie Jack Garmon Methods and systems for customer performance scoring
MD24Z (en) * 2008-12-02 2010-01-31 Василе ЖОВМИР Method of differential treatment of noninvasive mammary carcinoma
MD35Z (en) * 2008-12-02 2010-01-31 Василе ЖОВМИР Method for appreciating the risk of development of the noninvasive carcinoma in situ of the mammary gland
MD36Z (en) * 2008-12-02 2010-01-31 Василе ЖОВМИР Method for differential treatment of noninvasive ductal carcinoma in situ of mammary gland
MD23Z (en) * 2008-12-02 2010-01-31 Василе ЖОВМИР Method of differential treatment of noninvasive lobular mammary carcinoma in situ
DK3903829T3 (en) 2009-02-13 2023-06-26 Immunomedics Inc IMMUNE CONJUGATES WITH AN INTRACELLULAR CLEAVABLE BOND
ES2712732T3 (en) 2009-02-17 2019-05-14 Cornell Res Foundation Inc Methods and kits for the diagnosis of cancer and the prediction of therapeutic value
WO2010135313A1 (en) 2009-05-19 2010-11-25 Aic Blab Company Composite current collector and methods therefor
US8221753B2 (en) 2009-09-30 2012-07-17 Tracon Pharmaceuticals, Inc. Endoglin antibodies
CA2782194C (en) 2009-12-02 2018-01-16 Immunomedics, Inc. Combination of radiolabelled antibodies (rait) and antibody-drug conjugates (adc) for treatment of pancreatic cancer
EP3135302A1 (en) 2009-12-02 2017-03-01 Imaginab, Inc. J591 minibodies and cys-diabodies for targeting human prostate specific membrane antigen (psma) and methods for their use
CA3002192C (en) 2010-03-26 2023-03-07 Memorial Sloan-Kettering Cancer Center Antibodies to muc16 and methods of use thereof
JP5702944B2 (en) * 2010-03-31 2015-04-15 独立行政法人国立がん研究センター Biomarker
US9133239B2 (en) 2010-04-20 2015-09-15 The Research Foundation For The State University Of New York Compositions and methods for inhibiting matrix metalloproteinase (MMP)-mediated cell migration
JP6145404B2 (en) * 2010-05-07 2017-06-14 エフ・ホフマン−ラ・ロシュ・アクチェンゲゼルシャフト Diagnostic methods for ex vivo cell detection
US20120148559A1 (en) 2010-12-01 2012-06-14 Board Of Regents The University Of Texas System Compositions and method for deimmunization of proteins
US9433686B2 (en) 2011-01-31 2016-09-06 The Regents Of The University Of California Methods for treating castration resistant prostate cancer and metastasis by reducing B-cell number and/or function
CA2831572C (en) 2011-05-02 2019-11-26 Immunomedics, Inc. Ultrafiltration concentration of allotype selected antibodies for small-volume administration
NZ713941A (en) 2012-06-07 2017-02-24 Ambrx Inc Prostate-specific membrane antigen antibody drug conjugates
KR20150023729A (en) 2012-06-14 2015-03-05 암브룩스, 인코포레이티드 Anti-psma antibodies conjugated to nuclear receptor ligand polypeptides
CA2874864C (en) 2012-08-14 2023-02-21 Ibc Pharmaceuticals, Inc. T-cell redirecting bispecific antibodies for treatment of disease
UA115789C2 (en) 2012-09-05 2017-12-26 Трейкон Фармасутікалз, Інк. Antibody formulations and uses thereof
PT2766048E (en) 2012-10-12 2015-02-25 Spirogen Sarl Pyrrolobenzodiazepines and conjugates thereof
HUE057977T2 (en) 2012-12-13 2022-06-28 Immunomedics Inc Dosages of immunoconjugates of antibodies and sn-38 for improved efficacy and decreased toxicity
WO2017004144A1 (en) 2015-07-01 2017-01-05 Immunomedics, Inc. Antibody-sn-38 immunoconjugates with a cl2a linker
US11242399B2 (en) 2013-02-19 2022-02-08 Adienne S.A. Anti-CD26 antibodies
CA2905181C (en) 2013-03-13 2020-06-02 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof for providing targeted therapy
RU2668391C2 (en) 2013-03-15 2018-09-28 ИНТРИНСИК ЛАЙФСАЙЕНСИС ЭлЭлСи Anti-hepcidin antibodies and uses thereof
JP6908964B2 (en) 2013-10-18 2021-07-28 ピーエスエムエー ディベロップメント カンパニー,エルエルシー Combination therapy with PSMA ligand conjugate
WO2015073896A2 (en) 2013-11-15 2015-05-21 Psma Development Company, Llc Biomarkers for psma targeted therapy for prostate cancer
MX2016010683A (en) 2014-02-21 2017-05-11 Ibc Pharmaceuticals Inc Disease therapy by inducing immune response to trop-2 expressing cells.
US9139649B2 (en) 2014-02-25 2015-09-22 Immunomedics, Inc. Humanized anti-CD22 antibody
LT3151865T (en) 2014-05-22 2021-10-25 Byondis B.V. Site-specific conjugation of linker drugs to antibodies and resulting adcs
WO2015200260A1 (en) 2014-06-24 2015-12-30 Immunomedics, Inc. Anti-histone therapy for vascular necrosis in severe glomerulonephritis
WO2016037644A1 (en) 2014-09-10 2016-03-17 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
EP3197915A4 (en) 2014-09-22 2018-12-19 Intrinsic Lifesciences LLC Humanized anti-hepcidin antibodies and uses thereof
PL3204018T3 (en) 2014-10-07 2022-01-03 Immunomedics, Inc. Neoadjuvant use of antibody-drug conjugates
US10155820B2 (en) 2014-11-12 2018-12-18 Tracon Pharmaceuticals, Inc. Anti-endoglin antibodies and uses thereof
US9926375B2 (en) 2014-11-12 2018-03-27 Tracon Pharmaceuticals, Inc. Anti-endoglin antibodies and uses thereof
CN104447955B (en) * 2014-11-23 2018-04-20 南京市第一医院 A kind of polypeptide combined with PSMA film outskirt targetings and its application
EP3064507A1 (en) 2015-03-06 2016-09-07 Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts Fusion proteins comprising a binding protein and an interleukin-15 polypeptide having a reduced affinity for IL15ra and therapeutic uses thereof
US10722523B2 (en) 2015-03-17 2020-07-28 The Regents Of The University Of California Chemoimmunotherapy for epithelial cancer
US11066480B2 (en) 2015-03-17 2021-07-20 Memorial Sloan Kettering Cancer Center Anti-MUC16 antibodies and uses thereof
CA2981543A1 (en) 2015-04-22 2016-10-27 Immunomedics, Inc. Isolation, detection, diagnosis and/or characterization of circulating trop-2-positive cancer cells
CN107849148B (en) 2015-05-21 2023-09-19 哈普恩治疗公司 Trispecific binding proteins and methods of use
ES2953441T3 (en) 2015-06-25 2023-11-13 Immunomedics Inc Combination of anti-hla-dr or anti-Trop-2 antibodies with microtubule inhibitors, parp inhibitors, bruton kinase inhibitors or phosphoinositide 3-kinase inhibitors significantly improves therapeutic outcome in cancer
JOP20160154B1 (en) 2015-07-31 2021-08-17 Regeneron Pharma Anti-psma antibodies, bispecific antigen-binding molecules that bind psma and cd3, and uses thereof
SG10201913625XA (en) 2015-08-07 2020-03-30 Imaginab Inc Antigen binding constructs to target molecules
EP3192810A1 (en) * 2016-01-14 2017-07-19 Deutsches Krebsforschungszentrum Psma binding antibody and uses thereof
US11623958B2 (en) 2016-05-20 2023-04-11 Harpoon Therapeutics, Inc. Single chain variable fragment CD3 binding proteins
US10100106B2 (en) 2016-05-20 2018-10-16 Harpoon Therapeutics, Inc. Single domain serum albumin binding protein
EA201892693A1 (en) 2016-05-20 2019-04-30 Харпун Терапьютикс, Инк. PROTEINS CONTAINING A SINGLE-BANDY VARIABLE FRAGMENT, CONNECTING CD3
EP3464379B1 (en) 2016-06-06 2023-09-27 Abzena (UK) Limited Antibodies, uses thereof and conjugates thereof
GB201614162D0 (en) 2016-08-18 2016-10-05 Polytherics Ltd Antibodies, uses thereof and conjugates thereof
JP2019534882A (en) 2016-10-11 2019-12-05 メドイミューン・リミテッドMedImmune Limited Antibody-drug conjugates with immune-mediated therapeutics
JP7215997B2 (en) 2016-11-23 2023-01-31 ハープーン セラピューティクス,インク. Trispecific proteins targeting prostate specific membrane antigen (PSMA) and methods of use
AU2017363300A1 (en) 2016-11-23 2019-06-20 Harpoon Therapeutics, Inc. Prostate specific membrane antigen binding protein
US11266745B2 (en) 2017-02-08 2022-03-08 Imaginab, Inc. Extension sequences for diabodies
EP3589662A4 (en) 2017-02-28 2020-12-30 Harpoon Therapeutics, Inc. Inducible monovalent antigen binding protein
CA3063359A1 (en) 2017-05-12 2018-11-15 Harpoon Therapeutics, Inc. Mesothelin binding proteins
US10730954B2 (en) 2017-05-12 2020-08-04 Harpoon Therapeutics, Inc. MSLN targeting trispecific proteins and methods of use
CN111465612A (en) 2017-10-13 2020-07-28 哈普恩治疗公司 B cell maturation antigen binding proteins
AU2018347582A1 (en) 2017-10-13 2020-05-07 Harpoon Therapeutics, Inc. Trispecific proteins and methods of use
CN111511484A (en) 2017-11-04 2020-08-07 索纳纳米技术公司 Metal nanoparticles and method for preparing the same
AU2019231205A1 (en) 2018-03-06 2020-09-24 The Trustees Of The University Of Pennsylvania Prostate-specific membrane antigen cars and methods of use thereof
BR112020019611A2 (en) * 2018-03-29 2021-01-05 Ambrx, Inc. ANTI-ANTIGEN ANTIBODY CONJUGATES OF HUMANIZED PROSTATE SPECIFIC MEMBRANE (AMEP) AND DRUG
SG11202010469QA (en) 2018-05-23 2020-11-27 Adc Therapeutics Sa Molecular adjuvant
EP3587454A1 (en) * 2018-06-27 2020-01-01 Albert-Ludwigs-Universität Freiburg Chimeric antigen receptors that bind to prostate specific membrane antigen
RS63943B1 (en) 2018-07-31 2023-02-28 Heidelberg Pharma Res Gmbh Humanized antibodies against psma
AU2019346466A1 (en) 2018-09-25 2021-05-20 Harpoon Therapeutics, Inc. DLL3 binding proteins and methods of use
EP4106806A1 (en) 2020-02-21 2022-12-28 Harpoon Therapeutics, Inc. Flt3 binding proteins and methods of use
WO2022010797A2 (en) 2020-07-07 2022-01-13 Bionecure Therapeutics, Inc. Novel maytansinoids as adc payloads and their use for the treatment of cancer
WO2022079211A1 (en) 2020-10-16 2022-04-21 Adc Therapeutics Sa Glycoconjugates
CN112285082A (en) * 2020-10-28 2021-01-29 上海睿钰生物科技有限公司 Method for evaluating cell killing effect based on cell diameter and application thereof
GB202102396D0 (en) 2021-02-19 2021-04-07 Adc Therapeutics Sa Molecular adjuvant
JPWO2022239720A1 (en) 2021-05-10 2022-11-17

Citations (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4814275A (en) * 1985-05-13 1989-03-21 E.I. Dupont De Nemours And Company Monoclonal hybridoma antibody specific for a human epithelial antigen
US4863854A (en) * 1985-08-12 1989-09-05 Sloan-Kettering Institute For Cancer Research Monoclonal antibodies to mucin-like human differentiation antigens
US4863851A (en) * 1986-10-20 1989-09-05 The Upjohn Company Monoclonal antibody to prostate secretory protein
US5013645A (en) * 1987-04-14 1991-05-07 Abbott Laboratories Immunological methods and materials for detection of tumor associated antigens
US5118611A (en) * 1988-07-25 1992-06-02 Adeza Biomedical Corporation Adenocarcinoma antigen binding methods and reagents
US5162504A (en) * 1988-06-03 1992-11-10 Cytogen Corporation Monoclonal antibodies to a new antigenic marker in epithelial prostatic cells and serum of prostatic cancer patients
US5227471A (en) * 1992-01-30 1993-07-13 Eastern Virginia Medical School Of The Medical College Of Hampton Roads Monoclonal antibody PD41 that binds to a prostate mucin antigen that is expressed in human prostatic carcinoma
US5229289A (en) * 1988-03-11 1993-07-20 The Biomembrane Institute Monoclonal antibodies and vaccine development directed to human cancer-associated antigens by immunization with animal and human and with synthetic carbohydrate-carrier conjugates
US5342924A (en) * 1987-12-31 1994-08-30 Tanox Biosystems, Inc. Extracellular segments of human ε immunoglobulin anchoring peptides and antibodies specific therefor
US5489525A (en) * 1992-10-08 1996-02-06 The United States Of America As Represented By The Department Of Health And Human Services Monoclonal antibodies to prostate cells
US5538866A (en) * 1992-11-05 1996-07-23 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen
US5599677A (en) * 1993-12-29 1997-02-04 Abbott Laboratories Immunoassays for prostate specific antigen
US5855866A (en) * 1992-03-05 1999-01-05 Board Of Regenis, The University Of Texas System Methods for treating the vasculature of solid tumors
US5877289A (en) * 1992-03-05 1999-03-02 The Scripps Research Institute Tissue factor compositions and ligands for the specific coagulation of vasculature
US6649163B1 (en) * 1996-05-06 2003-11-18 Cornell Research Foundation, Inc. Treatment and diagnosis of cancer
US20040120958A1 (en) * 2001-06-01 2004-06-24 Bander Neil H. Modified antibodies to prostate-specific membrane antigen and uses thereof
US20040213791A1 (en) * 2001-06-01 2004-10-28 Neil Bander Modified antibodies to prostate-specific membrane antigen and uses thereof
US6962981B1 (en) * 1996-03-25 2005-11-08 Medarex, Inc. Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen

Family Cites Families (54)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4454106A (en) 1982-06-07 1984-06-12 Gansow Otto A Use of metal chelate conjugated monoclonal antibodies
US4472509A (en) 1982-06-07 1984-09-18 Gansow Otto A Metal chelate conjugated monoclonal antibodies
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4824986A (en) 1985-04-26 1989-04-25 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Metal chelate protein conjugate
US4735210A (en) 1985-07-05 1988-04-05 Immunomedics, Inc. Lymphographic and organ imaging method and kit
US5776093A (en) 1985-07-05 1998-07-07 Immunomedics, Inc. Method for imaging and treating organs and tissues
US5525338A (en) 1992-08-21 1996-06-11 Immunomedics, Inc. Detection and therapy of lesions with biotin/avidin conjugates
DE3684578D1 (en) * 1985-12-17 1992-04-30 Eastern Virginia Medical Autho MONOCLONAL ANTIBODIES WITH BINDING SPECIFICITY FOR HUMAN PROSTATATUM ORIGINAL AND METHODS FOR THEIR USE.
DE3772785D1 (en) 1986-01-23 1991-10-17 Squibb & Sons Inc 1-SUBSTITUTED-4,7,10-TRISCARBOXYMETHYL-1,4,7,10-TETRAAZACYCLODODECAN AND ANALOG.
MX174467B (en) 1986-01-23 1994-05-17 Squibb & Sons Inc 1,4,7-TRISCARBOXIMETHYL-1,4,7,10-TETRAAZACICLODO DECAN SUBSTITUTE IN 1 AND ANALOG COMPOUNDS
US4885363A (en) 1987-04-24 1989-12-05 E. R. Squibb & Sons, Inc. 1-substituted-1,4,7-triscarboxymethyl-1,4,7,10-tetraazacyclododecane and analogs
AU593611B2 (en) 1986-02-14 1990-02-15 Nihon Medi-Physics Co., Ltd. High molecular compounds having amino groups, and their utilization
WO1988002635A1 (en) 1986-10-17 1988-04-21 Cytogen Corporation Method for preparation of protein-chelator-metal ion compositions suitable for injection
US5057302A (en) 1987-02-13 1991-10-15 Abbott Laboratories Bifunctional chelating agents
CA1306739C (en) 1987-02-16 1992-08-25 Gohfu Suzukamo Solid base, process for preparing the same and use of the same in preparation of internal olefins
ES2086445T3 (en) 1987-07-16 1996-07-01 Nycomed Imaging As AMINO CARBOXYLIC ACIDS AND THEIR DERIVATIVES.
GB9007965D0 (en) 1990-04-09 1990-06-06 Nycomed As Compounds
US5531978A (en) 1987-07-16 1996-07-02 Nycomed Imaging As Aminopolycarboxylic acids and derivatives thereof
US5217704A (en) 1987-11-06 1993-06-08 Abbott Laboratories Methods and materials for the preparation of metal labelled antibody solutions
US5130118A (en) 1987-11-06 1992-07-14 Abbott Laboratories Methods and materials for the preparation of metal labelled antibody solutions
AU619218B2 (en) 1987-11-06 1992-01-23 Abbott Laboratories Methods and materials for the preparation of metal labelled antibody solutions
GB8801646D0 (en) 1988-01-26 1988-02-24 Nycomed As Chemical compounds
JPH03504510A (en) 1989-02-10 1991-10-03 セルテック リミテッド Azamacrocycle and its manufacturing method
US5053503A (en) 1989-02-17 1991-10-01 Centocor Chelating agents
DE3911816A1 (en) 1989-04-11 1990-10-25 Hoechst Ag SUBSTITUTED 1,4,7,10-TETRAAZACYCLOTRIDECANE, METHOD FOR THE PRODUCTION THEREOF AND THE USE THEREOF FOR MARKING SUBSTANCES WITH RADIONUCLIDES
US5244816A (en) 1989-10-11 1993-09-14 Akzo N.V. Method for purifying chelator conjugated compounds
WO1991007493A1 (en) 1989-11-13 1991-05-30 Xoma Corporation Chimeric mouse human antibodies with specificity to hiv antigens
GB8928874D0 (en) * 1989-12-21 1990-02-28 Celltech Ltd Humanised antibodies
GB9115192D0 (en) 1991-07-12 1991-08-28 Antisoma Ltd Cancer treatment
US6093399A (en) 1992-03-05 2000-07-25 Board Of Regents, The University Of Texas System Methods and compositions for the specific coagulation of vasculature
US5660827A (en) 1992-03-05 1997-08-26 Board Of Regents, The University Of Texas System Antibodies that bind to endoglin
US6004555A (en) 1992-03-05 1999-12-21 Board Of Regents, The University Of Texas System Methods for the specific coagulation of vasculature
US5965132A (en) 1992-03-05 1999-10-12 Board Of Regents, The University Of Texas System Methods and compositions for targeting the vasculature of solid tumors
US6036955A (en) 1992-03-05 2000-03-14 The Scripps Research Institute Kits and methods for the specific coagulation of vasculature
US5428156A (en) 1993-04-02 1995-06-27 Associated Universities, Inc. Synthesis of macrocyclic polyaminocarboxylates and their use for preparing stable radiometal antibody immunoconjugates for therapy, spect and pet imaging
KR100220864B1 (en) 1993-05-17 1999-09-15 오트리브 데이비스 더블유 Improved detection and therapy of lesions with biotin/avidin-metal chelating protein conjugates
US5935818A (en) 1995-02-24 1999-08-10 Sloan-Kettering Institute For Cancer Research Isolated nucleic acid molecule encoding alternatively spliced prostate-specific membrane antigen and uses thereof
AU2194695A (en) 1994-03-28 1995-10-17 Regents Of The University Of California, The Method for preparing radionuclide-labeled chelating agent-ligand complexes
US6693190B1 (en) 1994-05-11 2004-02-17 Bracco International B.V. Enhanced relaxivity monomeric and multimeric compounds
US5541087A (en) 1994-09-14 1996-07-30 Fuji Immunopharmaceuticals Corporation Expression and export technology of proteins as immunofusins
CA2212846A1 (en) 1995-02-24 1996-08-29 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen and uses thereof
US5773292A (en) 1995-06-05 1998-06-30 Cornell University Antibodies binding portions, and probes recognizing an antigen of prostate epithelial cells but not antigens circulating in the blood
DE69638134D1 (en) 1995-06-07 2010-04-08 Immunomedics Inc IMPROVED DELIVERY OF DIAGNOSTIC AND THERAPEUTIC SUBSTANCES AT ONE DESTINATION
IT1283218B1 (en) 1996-03-08 1998-04-16 Bracco Spa POLYKELANTS, THEIR COMPLEXES WITH METALLIC IONS, THEIR PREPARATION AND THEIR USES
US6150508A (en) 1996-03-25 2000-11-21 Northwest Biotherapeutics, Inc. Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen
ATE318147T1 (en) 1996-03-25 2006-03-15 Medarex Inc SPECIFIC MONOCLONAL ANTIBODIES FOR THE EXTRACELLULAR DOMAIN OF PROTASTA-SPECIFIC MEMBRANE ANTIGEN
US5804602A (en) 1996-06-17 1998-09-08 Guilford Pharmaceuticals Inc. Methods of cancer treatment using naaladase inhibitors
US5958474A (en) 1996-08-21 1999-09-28 Nestec S.A. Process for preparing food flavor precursors
IT1291623B1 (en) 1997-04-18 1999-01-11 Bracco Spa PROCEDURE FOR CONJUGATION OF CHELANTS WITH MOLECULES CONTAINING AMINE GROUPS
AU3305699A (en) 1998-02-26 1999-09-15 Beckman Coulter, Inc. Prostate-specific membrane antigens and methods of making and using
WO2000050457A1 (en) 1999-02-22 2000-08-31 Beckman Coulter, Inc. Prostate-specific membrane antigens and methods of making and using
US20020102208A1 (en) 1999-03-01 2002-08-01 Paul Chinn Radiolabeling kit and binding assay
JP2004510683A (en) 1999-06-07 2004-04-08 センター・フォー・モレキュラー・メディシン・アンド・イムノロジー Alpha or beta emitters attached to fragments in radioimmunotherapy
US6683162B2 (en) 2000-09-15 2004-01-27 Sloan Kettering Institute Of Cancer Research Targeted alpha particle therapy using actinium-255 conjugates

Patent Citations (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4814275A (en) * 1985-05-13 1989-03-21 E.I. Dupont De Nemours And Company Monoclonal hybridoma antibody specific for a human epithelial antigen
US4863854A (en) * 1985-08-12 1989-09-05 Sloan-Kettering Institute For Cancer Research Monoclonal antibodies to mucin-like human differentiation antigens
US4863851A (en) * 1986-10-20 1989-09-05 The Upjohn Company Monoclonal antibody to prostate secretory protein
US5013645A (en) * 1987-04-14 1991-05-07 Abbott Laboratories Immunological methods and materials for detection of tumor associated antigens
US5342924A (en) * 1987-12-31 1994-08-30 Tanox Biosystems, Inc. Extracellular segments of human ε immunoglobulin anchoring peptides and antibodies specific therefor
US5229289A (en) * 1988-03-11 1993-07-20 The Biomembrane Institute Monoclonal antibodies and vaccine development directed to human cancer-associated antigens by immunization with animal and human and with synthetic carbohydrate-carrier conjugates
US5162504A (en) * 1988-06-03 1992-11-10 Cytogen Corporation Monoclonal antibodies to a new antigenic marker in epithelial prostatic cells and serum of prostatic cancer patients
US5118611A (en) * 1988-07-25 1992-06-02 Adeza Biomedical Corporation Adenocarcinoma antigen binding methods and reagents
US5227471A (en) * 1992-01-30 1993-07-13 Eastern Virginia Medical School Of The Medical College Of Hampton Roads Monoclonal antibody PD41 that binds to a prostate mucin antigen that is expressed in human prostatic carcinoma
US5314996A (en) * 1992-01-30 1994-05-24 Eastern Virginia Medical School Of Medical College Of Hampton Roads Isolated nucleotide sequences encoding an: antigen binding site of monoclonal antibody PD41; and antigen associated with prostate adenocarcinomas
US5855866A (en) * 1992-03-05 1999-01-05 Board Of Regenis, The University Of Texas System Methods for treating the vasculature of solid tumors
US5877289A (en) * 1992-03-05 1999-03-02 The Scripps Research Institute Tissue factor compositions and ligands for the specific coagulation of vasculature
US5489525A (en) * 1992-10-08 1996-02-06 The United States Of America As Represented By The Department Of Health And Human Services Monoclonal antibodies to prostate cells
US5538866A (en) * 1992-11-05 1996-07-23 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen
US5599677A (en) * 1993-12-29 1997-02-04 Abbott Laboratories Immunoassays for prostate specific antigen
US6962981B1 (en) * 1996-03-25 2005-11-08 Medarex, Inc. Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen
US6649163B1 (en) * 1996-05-06 2003-11-18 Cornell Research Foundation, Inc. Treatment and diagnosis of cancer
US20040120958A1 (en) * 2001-06-01 2004-06-24 Bander Neil H. Modified antibodies to prostate-specific membrane antigen and uses thereof
US20040213791A1 (en) * 2001-06-01 2004-10-28 Neil Bander Modified antibodies to prostate-specific membrane antigen and uses thereof
US7045605B2 (en) * 2001-06-01 2006-05-16 Cornell Research Foundation, Inc. Modified antibodies to prostate-specific membrane antigen and uses thereof

Cited By (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6953668B1 (en) 1992-11-05 2005-10-11 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen
USRE43586E1 (en) 1992-11-05 2012-08-14 Sloan-Kettering Institute For Cancer Research Antibodies to prostate-specific membrane antigen
US20070148662A1 (en) * 1992-11-05 2007-06-28 Sloan Kettering Institute For Cancer Research Prostate-specific membrane antigen
US7070782B1 (en) 1992-11-05 2006-07-04 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen
US7399461B2 (en) 1993-11-05 2008-07-15 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen and uses thereof
US20040198657A1 (en) * 1993-11-05 2004-10-07 Heston Warren D. W. Prostate-specific membrane antigen and uses thereof
US20040001846A1 (en) * 1995-02-24 2004-01-01 Sloan-Kettering Institute For Cancer Research Prostate-specific membrane antigen and uses thereof
US20100310452A1 (en) * 1995-02-24 2010-12-09 Sloan Kettering Institute For Cancer Research Prostate-specific membrane antigen and uses thereof
US7045605B2 (en) 2001-06-01 2006-05-16 Cornell Research Foundation, Inc. Modified antibodies to prostate-specific membrane antigen and uses thereof
US20040120958A1 (en) * 2001-06-01 2004-06-24 Bander Neil H. Modified antibodies to prostate-specific membrane antigen and uses thereof
US20090280120A1 (en) * 2001-06-01 2009-11-12 Bander Neil H Methods of treating prostate cancer with anti-prostate specific membrane antigen antibodies
US20100278726A1 (en) * 2001-06-01 2010-11-04 Cornell Research Foundation, Inc. Modified Antibodies to Prostate-Specific Membrane Antigen and Uses Thereof
US7514078B2 (en) 2001-06-01 2009-04-07 Cornell Research Foundation, Inc. Methods of treating prostate cancer with anti-prostate specific membrane antigen antibodies
US20110165081A1 (en) * 2001-10-23 2011-07-07 Psma Development Company, Llc Psma antibodies and uses thereof
US8114965B2 (en) 2001-10-23 2012-02-14 Psma Development Company, Llc Compositions of PSMA antibodies
US9695248B2 (en) 2001-10-23 2017-07-04 Psma Development Company, Llc PSMA antibodies and uses thereof
US8470330B2 (en) 2001-10-23 2013-06-25 Psma Development Company, Llc PSMA antibodies and uses thereof
US20080286284A1 (en) * 2001-10-23 2008-11-20 Psma Development Company, Llc Compositions of PSMA antibodies
US7850971B2 (en) 2001-10-23 2010-12-14 Psma Development Company, Llc PSMA antibodies and protein multimers
US20040033229A1 (en) * 2001-10-23 2004-02-19 Maddon Paul J. PSMA antibodies and protein multimers
US20060062793A1 (en) * 2004-03-03 2006-03-23 Webb Iain J Modified antibodies to prostate-specific membrane antigen and uses thereof
US20110028696A1 (en) * 2005-02-18 2011-02-03 Medarex, Inc. Monoclonal antibodies against prostate specific membrane antigen (psma) lacking in fucosyl residues
US20090297438A1 (en) * 2005-02-18 2009-12-03 Haichun Huang Human Monoclonal Antibodies to Prostate Specific Membrane Antigen (PSMA)
US7875278B2 (en) 2005-02-18 2011-01-25 Medarex, Inc. Monoclonal antibodies against prostate specific membrane antigen (PSMA) lacking in fucosyl residues
US8461308B2 (en) 2005-02-18 2013-06-11 Medarex, Inc. Monoclonal antibodies against prostate specific membrane antigen (PSMA) lacking in fucosyl residues
US20090060908A1 (en) * 2005-02-18 2009-03-05 Medarex, Inc. Monoclonal Antibodies Against Prostate Specific Membrane Antigen (PSMA) Lacking in Fucosyl Residues
US8124738B2 (en) 2005-09-26 2012-02-28 Medarex, Inc. Human monoclonal antibodies to CD70
US20100150950A1 (en) * 2006-12-14 2010-06-17 Medarex, Inc. Human antibodies that bind cd70 and uses thereof
US9242012B2 (en) 2008-09-08 2016-01-26 Psma Development Company, Llc Methods for killing PSMA-expressing, taxane-resistant cancer cells
US20170138543A1 (en) * 2011-02-22 2017-05-18 Quarkstar Llc Solid State Lamp Using Light Emitting Strips
USD990174S1 (en) 2019-03-01 2023-06-27 Simplehuman, Llc Vanity mirror

Also Published As

Publication number Publication date
HK1025631A1 (en) 2000-11-17
CN1673744A (en) 2005-09-28
IL162230A0 (en) 2005-11-20
EP0956506B1 (en) 2006-03-01
DE69735368D1 (en) 2006-04-27
CA2261018C (en) 2008-06-03
WO1998003873A1 (en) 1998-01-29
CN1244921A (en) 2000-02-16
EP1655605A2 (en) 2006-05-10
DE69735368T2 (en) 2006-08-03
US7666425B1 (en) 2010-02-23
AU733544C (en) 2003-10-16
AU3797697A (en) 1998-02-10
ES2255723T3 (en) 2006-07-01
ATE319089T1 (en) 2006-03-15
EP0956506A4 (en) 2002-07-10
CN1165764C (en) 2004-09-08
EP0956506A1 (en) 1999-11-17
EP1655605A3 (en) 2006-08-30
IL127979A0 (en) 1999-11-30
CA2261018A1 (en) 1998-01-29
JP2002513378A (en) 2002-05-08
PT956506E (en) 2006-05-31
CN100344970C (en) 2007-10-24
US6107090A (en) 2000-08-22
JP2009197002A (en) 2009-09-03
JP5627191B2 (en) 2014-11-19
BR9710487A (en) 1999-08-17
NZ524036A (en) 2004-12-24
IL162230A (en) 2010-11-30
EA200400179A1 (en) 2004-06-24
JP4503102B2 (en) 2010-07-14
EA199900033A1 (en) 1999-08-26
US7112412B1 (en) 2006-09-26
NZ333683A (en) 2001-09-28
EA004634B1 (en) 2004-06-24
AU733544B2 (en) 2001-05-17

Similar Documents

Publication Publication Date Title
US6770450B1 (en) Treatment and diagnosis of cancer
US7112412B1 (en) Treatment and diagnosis of prostate cancer
WO1998003873A9 (en) Treatment and diagnosis of cancer
US6767711B2 (en) Treatment and diagnosis of prostate cancer
EP1841794B1 (en) Adam-9 modulators
US20030086929A1 (en) Treatment of prostate cancer by inhibitors of ATP synthase
EP1501544A2 (en) Alcam and alcam modulators
KR101380057B1 (en) Diagnostic agent and therapeutic agent for pancreatic cancer
CA2391450A1 (en) Targeted delivery of therapeutic and diagnostic moieties
US20220411532A1 (en) Antibodies targeting an amphiregulin-derived cell surface neo-epitope
MXPA99000642A (en) Derivatized rodamine tint and its copolime

Legal Events

Date Code Title Description
STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION