US20020013374A1 - Method of treating neurodegenerative disorders via inhibition of amyloid beta peptide binding - Google Patents
Method of treating neurodegenerative disorders via inhibition of amyloid beta peptide binding Download PDFInfo
- Publication number
- US20020013374A1 US20020013374A1 US09/320,885 US32088599A US2002013374A1 US 20020013374 A1 US20020013374 A1 US 20020013374A1 US 32088599 A US32088599 A US 32088599A US 2002013374 A1 US2002013374 A1 US 2002013374A1
- Authority
- US
- United States
- Prior art keywords
- alkyl
- disease
- hydrogen
- aralkyl
- compound
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 238000000034 method Methods 0.000 title claims abstract description 53
- 208000015122 neurodegenerative disease Diseases 0.000 title claims abstract description 32
- 102000013455 Amyloid beta-Peptides Human genes 0.000 title claims abstract description 31
- 108010090849 Amyloid beta-Peptides Proteins 0.000 title claims abstract description 31
- 230000027455 binding Effects 0.000 title claims description 40
- 230000005764 inhibitory process Effects 0.000 title description 4
- 150000001875 compounds Chemical class 0.000 claims abstract description 102
- 102000047725 alpha7 Nicotinic Acetylcholine Receptor Human genes 0.000 claims abstract description 20
- 108700006085 alpha7 Nicotinic Acetylcholine Receptor Proteins 0.000 claims abstract description 20
- 230000003993 interaction Effects 0.000 claims abstract description 15
- 208000024827 Alzheimer disease Diseases 0.000 claims description 58
- 102000019315 Nicotinic acetylcholine receptors Human genes 0.000 claims description 48
- 108050006807 Nicotinic acetylcholine receptors Proteins 0.000 claims description 48
- 125000001424 substituent group Chemical group 0.000 claims description 34
- 229910052739 hydrogen Inorganic materials 0.000 claims description 31
- 239000001257 hydrogen Substances 0.000 claims description 31
- 125000003710 aryl alkyl group Chemical group 0.000 claims description 30
- 125000004435 hydrogen atom Chemical group [H]* 0.000 claims description 30
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 claims description 29
- -1 diphenylphosphinyl Chemical group 0.000 claims description 26
- 125000003118 aryl group Chemical group 0.000 claims description 25
- 206010012289 Dementia Diseases 0.000 claims description 24
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 23
- 150000003839 salts Chemical class 0.000 claims description 19
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 claims description 17
- 125000003342 alkenyl group Chemical group 0.000 claims description 15
- 125000000217 alkyl group Chemical group 0.000 claims description 14
- 125000003386 piperidinyl group Chemical group 0.000 claims description 13
- 238000002156 mixing Methods 0.000 claims description 12
- 125000002757 morpholinyl group Chemical group 0.000 claims description 12
- 229940002612 prodrug Drugs 0.000 claims description 12
- 239000000651 prodrug Substances 0.000 claims description 12
- 125000000719 pyrrolidinyl group Chemical group 0.000 claims description 12
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 11
- 206010002022 amyloidosis Diseases 0.000 claims description 10
- 201000010099 disease Diseases 0.000 claims description 10
- 208000027747 Kennedy disease Diseases 0.000 claims description 9
- 208000003954 Spinal Muscular Atrophies of Childhood Diseases 0.000 claims description 9
- 229910052757 nitrogen Inorganic materials 0.000 claims description 9
- IJGRMHOSHXDMSA-UHFFFAOYSA-N nitrogen Substances N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 claims description 9
- 208000002320 spinal muscular atrophy Diseases 0.000 claims description 9
- 230000001225 therapeutic effect Effects 0.000 claims description 9
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 claims description 8
- 125000002887 hydroxy group Chemical group [H]O* 0.000 claims description 8
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 claims description 8
- 125000006700 (C1-C6) alkylthio group Chemical group 0.000 claims description 7
- 208000018737 Parkinson disease Diseases 0.000 claims description 7
- 125000003545 alkoxy group Chemical group 0.000 claims description 7
- 229910052736 halogen Inorganic materials 0.000 claims description 7
- 230000002401 inhibitory effect Effects 0.000 claims description 7
- 210000002569 neuron Anatomy 0.000 claims description 7
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 7
- 238000012360 testing method Methods 0.000 claims description 7
- 208000033526 Proximal spinal muscular atrophy type 3 Diseases 0.000 claims description 6
- 201000004810 Vascular dementia Diseases 0.000 claims description 6
- 208000006269 X-Linked Bulbo-Spinal Atrophy Diseases 0.000 claims description 6
- 230000007850 degeneration Effects 0.000 claims description 6
- 201000004815 juvenile spinal muscular atrophy Diseases 0.000 claims description 6
- 208000005264 motor neuron disease Diseases 0.000 claims description 6
- 201000002212 progressive supranuclear palsy Diseases 0.000 claims description 6
- 208000032527 type III spinal muscular atrophy Diseases 0.000 claims description 6
- SNICXCGAKADSCV-JTQLQIEISA-N (-)-Nicotine Chemical compound CN1CCC[C@H]1C1=CC=CN=C1 SNICXCGAKADSCV-JTQLQIEISA-N 0.000 claims description 5
- 125000004191 (C1-C6) alkoxy group Chemical group 0.000 claims description 5
- 125000004890 (C1-C6) alkylamino group Chemical group 0.000 claims description 5
- 125000006619 (C1-C6) dialkylamino group Chemical group 0.000 claims description 5
- 208000000323 Tourette Syndrome Diseases 0.000 claims description 5
- 230000002776 aggregation Effects 0.000 claims description 5
- 238000004220 aggregation Methods 0.000 claims description 5
- 125000004448 alkyl carbonyl group Chemical group 0.000 claims description 5
- 125000002785 azepinyl group Chemical group 0.000 claims description 5
- 208000010877 cognitive disease Diseases 0.000 claims description 5
- 125000000623 heterocyclic group Chemical group 0.000 claims description 5
- 239000008194 pharmaceutical composition Substances 0.000 claims description 5
- 125000004193 piperazinyl group Chemical group 0.000 claims description 5
- 125000003107 substituted aryl group Chemical group 0.000 claims description 5
- 125000004568 thiomorpholinyl group Chemical group 0.000 claims description 5
- 208000027382 Mental deterioration Diseases 0.000 claims description 4
- 206010027374 Mental impairment Diseases 0.000 claims description 4
- 230000001054 cortical effect Effects 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 4
- 238000012544 monitoring process Methods 0.000 claims description 4
- 229960002715 nicotine Drugs 0.000 claims description 4
- 238000004393 prognosis Methods 0.000 claims description 4
- 206010059245 Angiopathy Diseases 0.000 claims description 3
- 208000036487 Arthropathies Diseases 0.000 claims description 3
- 206010003591 Ataxia Diseases 0.000 claims description 3
- 102000007371 Ataxin-3 Human genes 0.000 claims description 3
- 201000006474 Brain Ischemia Diseases 0.000 claims description 3
- 206010006542 Bulbar palsy Diseases 0.000 claims description 3
- 208000029402 Bulbospinal muscular atrophy Diseases 0.000 claims description 3
- 206010068597 Bulbospinal muscular atrophy congenital Diseases 0.000 claims description 3
- 206010008120 Cerebral ischaemia Diseases 0.000 claims description 3
- 208000033647 Classic progressive supranuclear palsy syndrome Diseases 0.000 claims description 3
- 206010067889 Dementia with Lewy bodies Diseases 0.000 claims description 3
- 201000010374 Down Syndrome Diseases 0.000 claims description 3
- 206010016207 Familial Mediterranean fever Diseases 0.000 claims description 3
- 201000011240 Frontotemporal dementia Diseases 0.000 claims description 3
- 206010018985 Haemorrhage intracranial Diseases 0.000 claims description 3
- 206010019196 Head injury Diseases 0.000 claims description 3
- 208000023105 Huntington disease Diseases 0.000 claims description 3
- 208000008574 Intracranial Hemorrhages Diseases 0.000 claims description 3
- 208000012659 Joint disease Diseases 0.000 claims description 3
- 208000034800 Leukoencephalopathies Diseases 0.000 claims description 3
- 208000009829 Lewy Body Disease Diseases 0.000 claims description 3
- 208000002569 Machado-Joseph Disease Diseases 0.000 claims description 3
- 208000019090 Machado-Joseph disease type 3 Diseases 0.000 claims description 3
- 201000002795 Muckle-Wells syndrome Diseases 0.000 claims description 3
- 208000034578 Multiple myelomas Diseases 0.000 claims description 3
- 208000001089 Multiple system atrophy Diseases 0.000 claims description 3
- 206010033885 Paraparesis Diseases 0.000 claims description 3
- 208000000609 Pick Disease of the Brain Diseases 0.000 claims description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 3
- 208000032319 Primary lateral sclerosis Diseases 0.000 claims description 3
- 102000029797 Prion Human genes 0.000 claims description 3
- 108091000054 Prion Proteins 0.000 claims description 3
- 208000024777 Prion disease Diseases 0.000 claims description 3
- 208000032225 Proximal spinal muscular atrophy type 1 Diseases 0.000 claims description 3
- 208000021811 Sandhoff disease Diseases 0.000 claims description 3
- 208000009106 Shy-Drager Syndrome Diseases 0.000 claims description 3
- 208000002548 Spastic Paraparesis Diseases 0.000 claims description 3
- 208000036834 Spinocerebellar ataxia type 3 Diseases 0.000 claims description 3
- 208000037065 Subacute sclerosing leukoencephalitis Diseases 0.000 claims description 3
- 206010042297 Subacute sclerosing panencephalitis Diseases 0.000 claims description 3
- 208000032859 Synucleinopathies Diseases 0.000 claims description 3
- 208000022292 Tay-Sachs disease Diseases 0.000 claims description 3
- 206010044688 Trisomy 21 Diseases 0.000 claims description 3
- 206010046298 Upper motor neurone lesion Diseases 0.000 claims description 3
- 206010063661 Vascular encephalopathy Diseases 0.000 claims description 3
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 claims description 3
- 208000026481 Werdnig-Hoffmann disease Diseases 0.000 claims description 3
- 210000000601 blood cell Anatomy 0.000 claims description 3
- 230000006931 brain damage Effects 0.000 claims description 3
- 231100000874 brain damage Toxicity 0.000 claims description 3
- 208000029028 brain injury Diseases 0.000 claims description 3
- 230000000747 cardiac effect Effects 0.000 claims description 3
- 230000002490 cerebral effect Effects 0.000 claims description 3
- 206010008118 cerebral infarction Diseases 0.000 claims description 3
- 230000001684 chronic effect Effects 0.000 claims description 3
- 208000022993 cryopyrin-associated periodic syndrome Diseases 0.000 claims description 3
- 230000003412 degenerative effect Effects 0.000 claims description 3
- 208000017004 dementia pugilistica Diseases 0.000 claims description 3
- 230000003073 embolic effect Effects 0.000 claims description 3
- 230000002124 endocrine Effects 0.000 claims description 3
- 201000006061 fatal familial insomnia Diseases 0.000 claims description 3
- 210000001652 frontal lobe Anatomy 0.000 claims description 3
- 238000001631 haemodialysis Methods 0.000 claims description 3
- 230000000322 hemodialysis Effects 0.000 claims description 3
- 208000008675 hereditary spastic paraplegia Diseases 0.000 claims description 3
- 238000007917 intracranial administration Methods 0.000 claims description 3
- 206010023497 kuru Diseases 0.000 claims description 3
- 201000010901 lateral sclerosis Diseases 0.000 claims description 3
- 230000003902 lesion Effects 0.000 claims description 3
- 201000000564 macroglobulinemia Diseases 0.000 claims description 3
- 230000002503 metabolic effect Effects 0.000 claims description 3
- 230000005015 neuronal process Effects 0.000 claims description 3
- SNICXCGAKADSCV-UHFFFAOYSA-N nicotine Natural products CN1CCCC1C1=CC=CN=C1 SNICXCGAKADSCV-UHFFFAOYSA-N 0.000 claims description 3
- 208000031237 olivopontocerebellar atrophy Diseases 0.000 claims description 3
- 208000001282 primary progressive aphasia Diseases 0.000 claims description 3
- 208000032207 progressive 1 supranuclear palsy Diseases 0.000 claims description 3
- 201000002241 progressive bulbar palsy Diseases 0.000 claims description 3
- 206010036807 progressive multifocal leukoencephalopathy Diseases 0.000 claims description 3
- 201000000196 pseudobulbar palsy Diseases 0.000 claims description 3
- 230000001148 spastic effect Effects 0.000 claims description 3
- 208000003755 striatonigral degeneration Diseases 0.000 claims description 3
- 230000001732 thrombotic effect Effects 0.000 claims description 3
- 208000032471 type 1 spinal muscular atrophy Diseases 0.000 claims description 3
- 125000000229 (C1-C4)alkoxy group Chemical group 0.000 claims description 2
- 125000004916 (C1-C6) alkylcarbonyl group Chemical group 0.000 claims description 2
- 125000003282 alkyl amino group Chemical group 0.000 claims description 2
- 125000004663 dialkyl amino group Chemical group 0.000 claims description 2
- 102000005962 receptors Human genes 0.000 claims description 2
- 108020003175 receptors Proteins 0.000 claims description 2
- 238000012216 screening Methods 0.000 claims description 2
- 150000002367 halogens Chemical group 0.000 claims 5
- POPPVIRYGJQIOF-UHFFFAOYSA-N 2-acetyloxyethyl(trimethyl)azanium;3-(1-methylpyrrolidin-2-yl)pyridine Chemical compound CC(=O)OCC[N+](C)(C)C.CN1CCCC1C1=CC=CN=C1 POPPVIRYGJQIOF-UHFFFAOYSA-N 0.000 claims 3
- 102000009660 Cholinergic Receptors Human genes 0.000 claims 3
- 108010009685 Cholinergic Receptors Proteins 0.000 claims 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 54
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 42
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 35
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 33
- 239000000243 solution Substances 0.000 description 29
- HEDRZPFGACZZDS-MICDWDOJSA-N Trichloro(2H)methane Chemical compound [2H]C(Cl)(Cl)Cl HEDRZPFGACZZDS-MICDWDOJSA-N 0.000 description 28
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 27
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 25
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 24
- 238000005160 1H NMR spectroscopy Methods 0.000 description 20
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 20
- 235000019439 ethyl acetate Nutrition 0.000 description 20
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 18
- 102000015296 acetylcholine-gated cation-selective channel activity proteins Human genes 0.000 description 16
- 108040006409 acetylcholine-gated cation-selective channel activity proteins Proteins 0.000 description 16
- 239000011541 reaction mixture Substances 0.000 description 16
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 15
- 238000006243 chemical reaction Methods 0.000 description 15
- 239000000203 mixture Substances 0.000 description 15
- 239000003921 oil Substances 0.000 description 15
- 235000019198 oils Nutrition 0.000 description 15
- 238000002360 preparation method Methods 0.000 description 15
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 14
- 239000012044 organic layer Substances 0.000 description 13
- 102000004196 processed proteins & peptides Human genes 0.000 description 13
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 11
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 11
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 10
- 239000000463 material Substances 0.000 description 10
- 125000000325 methylidene group Chemical group [H]C([H])=* 0.000 description 10
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 9
- 239000007787 solid Substances 0.000 description 9
- OKKJLVBELUTLKV-MZCSYVLQSA-N Deuterated methanol Chemical compound [2H]OC([2H])([2H])[2H] OKKJLVBELUTLKV-MZCSYVLQSA-N 0.000 description 8
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 8
- NBBJYMSMWIIQGU-UHFFFAOYSA-N Propionic aldehyde Chemical compound CCC=O NBBJYMSMWIIQGU-UHFFFAOYSA-N 0.000 description 8
- 230000006933 amyloid-beta aggregation Effects 0.000 description 8
- ILAHWRKJUDSMFH-UHFFFAOYSA-N boron tribromide Chemical compound BrB(Br)Br ILAHWRKJUDSMFH-UHFFFAOYSA-N 0.000 description 8
- 238000003818 flash chromatography Methods 0.000 description 8
- 239000000047 product Substances 0.000 description 8
- 239000002904 solvent Substances 0.000 description 8
- UXSXWUZYDJNSIZ-UHFFFAOYSA-N 5,8-dimethoxy-3-methyl-3,4-dihydro-1h-naphthalen-2-one Chemical compound C1C(=O)C(C)CC2=C1C(OC)=CC=C2OC UXSXWUZYDJNSIZ-UHFFFAOYSA-N 0.000 description 7
- 101710137189 Amyloid-beta A4 protein Proteins 0.000 description 7
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 7
- 101710151993 Amyloid-beta precursor protein Proteins 0.000 description 7
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 7
- OIPILFWXSMYKGL-UHFFFAOYSA-N acetylcholine Chemical compound CC(=O)OCC[N+](C)(C)C OIPILFWXSMYKGL-UHFFFAOYSA-N 0.000 description 7
- 229960004373 acetylcholine Drugs 0.000 description 7
- 230000000694 effects Effects 0.000 description 7
- 108090000623 proteins and genes Proteins 0.000 description 7
- BEOOHQFXGBMRKU-UHFFFAOYSA-N sodium cyanoborohydride Chemical compound [Na+].[B-]C#N BEOOHQFXGBMRKU-UHFFFAOYSA-N 0.000 description 7
- 229940086542 triethylamine Drugs 0.000 description 7
- 101710195183 Alpha-bungarotoxin Proteins 0.000 description 6
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 6
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 6
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 6
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 6
- XLTANAWLDBYGFU-UHFFFAOYSA-N methyllycaconitine hydrochloride Natural products C1CC(OC)C2(C3C4OC)C5CC(C(C6)OC)C(OC)C5C6(O)C4(O)C2N(CC)CC31COC(=O)C1=CC=CC=C1N1C(=O)CC(C)C1=O XLTANAWLDBYGFU-UHFFFAOYSA-N 0.000 description 6
- 235000018102 proteins Nutrition 0.000 description 6
- 102000004169 proteins and genes Human genes 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 239000000377 silicon dioxide Substances 0.000 description 6
- 229910052938 sodium sulfate Inorganic materials 0.000 description 6
- 238000003756 stirring Methods 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- LYTCVQQGCSNFJU-LKGYBJPKSA-N α-bungarotoxin Chemical compound C(/[C@H]1O[C@H]2C[C@H]3O[C@@H](CC(=C)C=O)C[C@H](O)[C@]3(C)O[C@@H]2C[C@@H]1O[C@@H]1C2)=C/C[C@]1(C)O[C@H]1[C@@]2(C)O[C@]2(C)CC[C@@H]3O[C@@H]4C[C@]5(C)O[C@@H]6C(C)=CC(=O)O[C@H]6C[C@H]5O[C@H]4C[C@@H](C)[C@H]3O[C@H]2C1 LYTCVQQGCSNFJU-LKGYBJPKSA-N 0.000 description 6
- BTPGWBISYWRXQH-UHFFFAOYSA-N COC1=CC=C(OC)C2=C1CC(C)C(N(C)C)C2C Chemical compound COC1=CC=C(OC)C2=C1CC(C)C(N(C)C)C2C BTPGWBISYWRXQH-UHFFFAOYSA-N 0.000 description 5
- KDLHZDBZIXYQEI-UHFFFAOYSA-N Palladium Chemical compound [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 5
- RWCCWEUUXYIKHB-UHFFFAOYSA-N benzophenone Chemical compound C=1C=CC=CC=1C(=O)C1=CC=CC=C1 RWCCWEUUXYIKHB-UHFFFAOYSA-N 0.000 description 5
- 125000004432 carbon atom Chemical group C* 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 229940011871 estrogen Drugs 0.000 description 5
- 239000000262 estrogen Substances 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 229940095743 selective estrogen receptor modulator Drugs 0.000 description 5
- 239000000333 selective estrogen receptor modulator Substances 0.000 description 5
- 235000011152 sodium sulphate Nutrition 0.000 description 5
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 5
- QIHMHQSDIGSQLM-LDYMZIIASA-N (2r,3r)-5,8-dimethoxy-3-methyl-1,2,3,4-tetrahydronaphthalen-2-ol Chemical compound C1[C@@H](O)[C@H](C)CC2=C1C(OC)=CC=C2OC QIHMHQSDIGSQLM-LDYMZIIASA-N 0.000 description 4
- CYLQOSYMZHZRBY-UHFFFAOYSA-N 6-methyl-5,8-dihydronaphthalene-1,4-diol Chemical compound C1=CC(O)=C2CC(C)=CCC2=C1O CYLQOSYMZHZRBY-UHFFFAOYSA-N 0.000 description 4
- 208000000044 Amnesia Diseases 0.000 description 4
- 208000037259 Amyloid Plaque Diseases 0.000 description 4
- IAZDPXIOMUYVGZ-WFGJKAKNSA-N Dimethyl sulfoxide Chemical compound [2H]C([2H])([2H])S(=O)C([2H])([2H])[2H] IAZDPXIOMUYVGZ-WFGJKAKNSA-N 0.000 description 4
- RRHGJUQNOFWUDK-UHFFFAOYSA-N Isoprene Chemical compound CC(=C)C=C RRHGJUQNOFWUDK-UHFFFAOYSA-N 0.000 description 4
- 208000026139 Memory disease Diseases 0.000 description 4
- 206010029350 Neurotoxicity Diseases 0.000 description 4
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 4
- 206010044221 Toxic encephalopathy Diseases 0.000 description 4
- 230000005856 abnormality Effects 0.000 description 4
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 210000004556 brain Anatomy 0.000 description 4
- ZTQSAGDEMFDKMZ-UHFFFAOYSA-N butyric aldehyde Natural products CCCC=O ZTQSAGDEMFDKMZ-UHFFFAOYSA-N 0.000 description 4
- 210000004027 cell Anatomy 0.000 description 4
- 125000001072 heteroaryl group Chemical group 0.000 description 4
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 4
- 150000002576 ketones Chemical class 0.000 description 4
- 210000004698 lymphocyte Anatomy 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 230000006984 memory degeneration Effects 0.000 description 4
- 208000023060 memory loss Diseases 0.000 description 4
- 231100000228 neurotoxicity Toxicity 0.000 description 4
- 230000007135 neurotoxicity Effects 0.000 description 4
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 4
- WGYKZJWCGVVSQN-UHFFFAOYSA-N propylamine Chemical compound CCCN WGYKZJWCGVVSQN-UHFFFAOYSA-N 0.000 description 4
- 210000003568 synaptosome Anatomy 0.000 description 4
- AZQWKYJCGOJGHM-UHFFFAOYSA-N 1,4-benzoquinone Chemical compound O=C1C=CC(=O)C=C1 AZQWKYJCGOJGHM-UHFFFAOYSA-N 0.000 description 3
- OUYUVYDFTMLUGJ-UHFFFAOYSA-N 5,8-dimethoxy-2-methyl-1,4-dihydronaphthalene Chemical compound C1C(C)=CCC2=C1C(OC)=CC=C2OC OUYUVYDFTMLUGJ-UHFFFAOYSA-N 0.000 description 3
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 3
- 229910015845 BBr3 Inorganic materials 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 150000001412 amines Chemical class 0.000 description 3
- 235000001014 amino acid Nutrition 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 3
- 239000012267 brine Substances 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000010828 elution Methods 0.000 description 3
- 239000001530 fumaric acid Substances 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 150000005217 methyl ethers Chemical class 0.000 description 3
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 3
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- YJLIKUSWRSEPSM-WGQQHEPDSA-N (2r,3r,4s,5r)-2-[6-amino-8-[(4-phenylphenyl)methylamino]purin-9-yl]-5-(hydroxymethyl)oxolane-3,4-diol Chemical compound C=1C=C(C=2C=CC=CC=2)C=CC=1CNC1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O YJLIKUSWRSEPSM-WGQQHEPDSA-N 0.000 description 2
- YGUFFGYYYUTFCO-YADARESESA-N (2r,3s)-5,8-dimethoxy-3-methyl-n-[4-(2-piperidin-1-ylethoxy)phenyl]-1,2,3,4-tetrahydronaphthalen-2-amine Chemical compound N([C@@H]1CC=2C(OC)=CC=C(C=2C[C@@H]1C)OC)C(C=C1)=CC=C1OCCN1CCCCC1 YGUFFGYYYUTFCO-YADARESESA-N 0.000 description 2
- 229930182840 (S)-nicotine Natural products 0.000 description 2
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 2
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- 125000000175 2-thienyl group Chemical group S1C([*])=C([H])C([H])=C1[H] 0.000 description 2
- NLPRAJRHRHZCQQ-UHFFFAOYSA-N 3-(6-chloro-3-pyridinyl)-7-azabicyclo[2.2.1]heptane Chemical compound C1=NC(Cl)=CC=C1C1C(N2)CCC2C1 NLPRAJRHRHZCQQ-UHFFFAOYSA-N 0.000 description 2
- 125000006201 3-phenylpropyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 2
- UIBFFIQQEATAMI-UHFFFAOYSA-N 5,8-bis(diphenylphosphoryl)-2-methyl-1,2,3,4-tetrahydronaphthalene Chemical compound C1C(C)CCC2=C1C(P(=O)(C=1C=CC=CC=1)C=1C=CC=CC=1)=CC=C2P(=O)(C=1C=CC=CC=1)C1=CC=CC=C1 UIBFFIQQEATAMI-UHFFFAOYSA-N 0.000 description 2
- 101800001718 Amyloid-beta protein Proteins 0.000 description 2
- 206010003062 Apraxia Diseases 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- RYUGKVNBZSEVRW-UHFFFAOYSA-N CC1CC2=C(C(O)=CC=C2O)C(C)C1N(C)C Chemical compound CC1CC2=C(C(O)=CC=C2O)C(C)C1N(C)C RYUGKVNBZSEVRW-UHFFFAOYSA-N 0.000 description 2
- 208000034656 Contusions Diseases 0.000 description 2
- 206010012239 Delusion Diseases 0.000 description 2
- 238000005698 Diels-Alder reaction Methods 0.000 description 2
- LCGLNKUTAGEVQW-UHFFFAOYSA-N Dimethyl ether Chemical compound COC LCGLNKUTAGEVQW-UHFFFAOYSA-N 0.000 description 2
- ZQZFYGIXNQKOAV-OCEACIFDSA-N Droloxifene Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=C(O)C=CC=1)\C1=CC=C(OCCN(C)C)C=C1 ZQZFYGIXNQKOAV-OCEACIFDSA-N 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- QIGBRXMKCJKVMJ-UHFFFAOYSA-N Hydroquinone Chemical compound OC1=CC=C(O)C=C1 QIGBRXMKCJKVMJ-UHFFFAOYSA-N 0.000 description 2
- JJKOTMDDZAJTGQ-DQSJHHFOSA-N Idoxifene Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN2CCCC2)=CC=1)/C1=CC=C(I)C=C1 JJKOTMDDZAJTGQ-DQSJHHFOSA-N 0.000 description 2
- 208000034693 Laceration Diseases 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- YNAVUWVOSKDBBP-UHFFFAOYSA-N Morpholine Chemical compound C1COCCN1 YNAVUWVOSKDBBP-UHFFFAOYSA-N 0.000 description 2
- 102000012547 Olfactory receptors Human genes 0.000 description 2
- 108050002069 Olfactory receptors Proteins 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 208000032023 Signs and Symptoms Diseases 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 208000016620 Tourette disease Diseases 0.000 description 2
- 108010046516 Wheat Germ Agglutinins Proteins 0.000 description 2
- 230000003941 amyloidogenesis Effects 0.000 description 2
- 210000003050 axon Anatomy 0.000 description 2
- 239000002585 base Substances 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- 239000012965 benzophenone Substances 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 125000004369 butenyl group Chemical group C(=CCC)* 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 229960001231 choline Drugs 0.000 description 2
- 230000001713 cholinergic effect Effects 0.000 description 2
- 230000001149 cognitive effect Effects 0.000 description 2
- 230000009137 competitive binding Effects 0.000 description 2
- 230000006835 compression Effects 0.000 description 2
- 238000007906 compression Methods 0.000 description 2
- 230000009519 contusion Effects 0.000 description 2
- 238000002425 crystallisation Methods 0.000 description 2
- 230000008025 crystallization Effects 0.000 description 2
- 230000006735 deficit Effects 0.000 description 2
- 231100000868 delusion Toxicity 0.000 description 2
- 230000017858 demethylation Effects 0.000 description 2
- 238000010520 demethylation reaction Methods 0.000 description 2
- 229950004203 droloxifene Drugs 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000001704 evaporation Methods 0.000 description 2
- 230000008020 evaporation Effects 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 230000005021 gait Effects 0.000 description 2
- 125000005843 halogen group Chemical group 0.000 description 2
- 125000005842 heteroatom Chemical group 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 229950002248 idoxifene Drugs 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- INQOMBQAUSQDDS-UHFFFAOYSA-N iodomethane Chemical compound IC INQOMBQAUSQDDS-UHFFFAOYSA-N 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N isopropyl alcohol Natural products CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 2
- 125000001160 methoxycarbonyl group Chemical group [H]C([H])([H])OC(*)=O 0.000 description 2
- 210000003928 nasal cavity Anatomy 0.000 description 2
- 210000003757 neuroblast Anatomy 0.000 description 2
- 230000002981 neuropathic effect Effects 0.000 description 2
- CTSLXHKWHWQRSH-UHFFFAOYSA-N oxalyl chloride Chemical compound ClC(=O)C(Cl)=O CTSLXHKWHWQRSH-UHFFFAOYSA-N 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 230000007170 pathology Effects 0.000 description 2
- 230000035515 penetration Effects 0.000 description 2
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 2
- 229910000027 potassium carbonate Inorganic materials 0.000 description 2
- 238000012746 preparative thin layer chromatography Methods 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 125000003226 pyrazolyl group Chemical group 0.000 description 2
- LEHBURLTIWGHEM-UHFFFAOYSA-N pyridinium chlorochromate Chemical compound [O-][Cr](Cl)(=O)=O.C1=CC=[NH+]C=C1 LEHBURLTIWGHEM-UHFFFAOYSA-N 0.000 description 2
- 125000004076 pyridyl group Chemical group 0.000 description 2
- 125000000168 pyrrolyl group Chemical group 0.000 description 2
- 125000002943 quinolinyl group Chemical group N1=C(C=CC2=CC=CC=C12)* 0.000 description 2
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 2
- 229960004622 raloxifene Drugs 0.000 description 2
- 238000006268 reductive amination reaction Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 239000000741 silica gel Substances 0.000 description 2
- 229910002027 silica gel Inorganic materials 0.000 description 2
- 239000012453 solvate Substances 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 229960001603 tamoxifen Drugs 0.000 description 2
- 102000013498 tau Proteins Human genes 0.000 description 2
- 108010026424 tau Proteins Proteins 0.000 description 2
- YLQBMQCUIZJEEH-UHFFFAOYSA-N tetrahydrofuran Natural products C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 2
- 125000001113 thiadiazolyl group Chemical group 0.000 description 2
- 125000001544 thienyl group Chemical group 0.000 description 2
- 238000004809 thin layer chromatography Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- QQJLHRRUATVHED-UHFFFAOYSA-N tramazoline Chemical compound N1CCN=C1NC1=CC=CC2=C1CCCC2 QQJLHRRUATVHED-UHFFFAOYSA-N 0.000 description 2
- 229960001262 tramazoline Drugs 0.000 description 2
- 125000001425 triazolyl group Chemical group 0.000 description 2
- GCTFTMWXZFLTRR-GFCCVEGCSA-N (2r)-2-amino-n-[3-(difluoromethoxy)-4-(1,3-oxazol-5-yl)phenyl]-4-methylpentanamide Chemical compound FC(F)OC1=CC(NC(=O)[C@H](N)CC(C)C)=CC=C1C1=CN=CO1 GCTFTMWXZFLTRR-GFCCVEGCSA-N 0.000 description 1
- QFLWZFQWSBQYPS-AWRAUJHKSA-N (3S)-3-[[(2S)-2-[[(2S)-2-[5-[(3aS,6aR)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-4-[1-bis(4-chlorophenoxy)phosphorylbutylamino]-4-oxobutanoic acid Chemical compound CCCC(NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)CCCCC1SC[C@@H]2NC(=O)N[C@H]12)C(C)C)P(=O)(Oc1ccc(Cl)cc1)Oc1ccc(Cl)cc1 QFLWZFQWSBQYPS-AWRAUJHKSA-N 0.000 description 1
- YQOLEILXOBUDMU-KRWDZBQOSA-N (4R)-5-[(6-bromo-3-methyl-2-pyrrolidin-1-ylquinoline-4-carbonyl)amino]-4-(2-chlorophenyl)pentanoic acid Chemical compound CC1=C(C2=C(C=CC(=C2)Br)N=C1N3CCCC3)C(=O)NC[C@H](CCC(=O)O)C4=CC=CC=C4Cl YQOLEILXOBUDMU-KRWDZBQOSA-N 0.000 description 1
- WSLDOOZREJYCGB-UHFFFAOYSA-N 1,2-Dichloroethane Chemical compound ClCCCl WSLDOOZREJYCGB-UHFFFAOYSA-N 0.000 description 1
- HLQQRQNEDYOBHS-UHFFFAOYSA-N 1-(2-(4-nitrophenoxy)ethyl)piperidine Chemical compound C1=CC([N+](=O)[O-])=CC=C1OCCN1CCCCC1 HLQQRQNEDYOBHS-UHFFFAOYSA-N 0.000 description 1
- OBCFOPGCTNULTG-UHFFFAOYSA-N 1-(2-chloroethoxy)-4-nitrobenzene Chemical compound [O-][N+](=O)C1=CC=C(OCCCl)C=C1 OBCFOPGCTNULTG-UHFFFAOYSA-N 0.000 description 1
- LOYZVRIHVZEDMW-UHFFFAOYSA-N 1-bromo-3-methylbut-2-ene Chemical compound CC(C)=CCBr LOYZVRIHVZEDMW-UHFFFAOYSA-N 0.000 description 1
- DURPTKYDGMDSBL-UHFFFAOYSA-N 1-butoxybutane Chemical compound CCCCOCCCC DURPTKYDGMDSBL-UHFFFAOYSA-N 0.000 description 1
- PYRKKGOKRMZEIT-UHFFFAOYSA-N 2-[6-(2-cyclopropylethoxy)-9-(2-hydroxy-2-methylpropyl)-1h-phenanthro[9,10-d]imidazol-2-yl]-5-fluorobenzene-1,3-dicarbonitrile Chemical compound C1=C2C3=CC(CC(C)(O)C)=CC=C3C=3NC(C=4C(=CC(F)=CC=4C#N)C#N)=NC=3C2=CC=C1OCCC1CC1 PYRKKGOKRMZEIT-UHFFFAOYSA-N 0.000 description 1
- 125000004493 2-methylbut-1-yl group Chemical group CC(C*)CC 0.000 description 1
- CEBKHWWANWSNTI-UHFFFAOYSA-N 2-methylbut-3-yn-2-ol Chemical compound CC(C)(O)C#C CEBKHWWANWSNTI-UHFFFAOYSA-N 0.000 description 1
- 125000005916 2-methylpentyl group Chemical group 0.000 description 1
- VTBHKDHFDNLZNG-UHFFFAOYSA-N 4-(2-piperidin-1-ylethoxy)aniline Chemical compound C1=CC(N)=CC=C1OCCN1CCCCC1 VTBHKDHFDNLZNG-UHFFFAOYSA-N 0.000 description 1
- XFJBGINZIMNZBW-CRAIPNDOSA-N 5-chloro-2-[4-[(1r,2s)-2-[2-(5-methylsulfonylpyridin-2-yl)oxyethyl]cyclopropyl]piperidin-1-yl]pyrimidine Chemical compound N1=CC(S(=O)(=O)C)=CC=C1OCC[C@H]1[C@@H](C2CCN(CC2)C=2N=CC(Cl)=CN=2)C1 XFJBGINZIMNZBW-CRAIPNDOSA-N 0.000 description 1
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 102000001049 Amyloid Human genes 0.000 description 1
- 108010094108 Amyloid Proteins 0.000 description 1
- 102100029470 Apolipoprotein E Human genes 0.000 description 1
- 101710095339 Apolipoprotein E Proteins 0.000 description 1
- 230000006970 Aβ cytotoxicity Effects 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- POIKARWODDSIKE-UHFFFAOYSA-N C#CC(=C)C.C#CC(C)(C)O.C=C(C)C(=C)/N=[Pr]/[Pr].CC1=C(/N=[Pr]/[Pr])CC2=C(O)C=CC(O)=C2C1.CC1=C(/N=[Pr]/[Pr])CC2C(=O)C=CC(=O)C2C1.CC1CC2=C(O)C=CC(O)=C2CC1/N=[Pr]/[Pr].[Ac]O[Hg]O[Ac] Chemical compound C#CC(=C)C.C#CC(C)(C)O.C=C(C)C(=C)/N=[Pr]/[Pr].CC1=C(/N=[Pr]/[Pr])CC2=C(O)C=CC(O)=C2C1.CC1=C(/N=[Pr]/[Pr])CC2C(=O)C=CC(=O)C2C1.CC1CC2=C(O)C=CC(O)=C2CC1/N=[Pr]/[Pr].[Ac]O[Hg]O[Ac] POIKARWODDSIKE-UHFFFAOYSA-N 0.000 description 1
- MYSFLPGVGJHDEJ-UHFFFAOYSA-N C.CC(C)(C)CC(=O)NCC1=CC=CC=C1 Chemical compound C.CC(C)(C)CC(=O)NCC1=CC=CC=C1 MYSFLPGVGJHDEJ-UHFFFAOYSA-N 0.000 description 1
- MUGDVXSXWCODGS-UHFFFAOYSA-N COC1=CC=C(OC)C2=C1CC(C)C(N(C)C)C2 Chemical compound COC1=CC=C(OC)C2=C1CC(C)C(N(C)C)C2 MUGDVXSXWCODGS-UHFFFAOYSA-N 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 208000028698 Cognitive impairment Diseases 0.000 description 1
- 229940126639 Compound 33 Drugs 0.000 description 1
- 208000031124 Dementia Alzheimer type Diseases 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 102000004086 Ligand-Gated Ion Channels Human genes 0.000 description 1
- 108090000543 Ligand-Gated Ion Channels Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 101100440173 Mus musculus Clu gene Proteins 0.000 description 1
- LVDRREOUMKACNJ-BKMJKUGQSA-N N-[(2R,3S)-2-(4-chlorophenyl)-1-(1,4-dimethyl-2-oxoquinolin-7-yl)-6-oxopiperidin-3-yl]-2-methylpropane-1-sulfonamide Chemical compound CC(C)CS(=O)(=O)N[C@H]1CCC(=O)N([C@@H]1c1ccc(Cl)cc1)c1ccc2c(C)cc(=O)n(C)c2c1 LVDRREOUMKACNJ-BKMJKUGQSA-N 0.000 description 1
- 239000007832 Na2SO4 Substances 0.000 description 1
- 235000019502 Orange oil Nutrition 0.000 description 1
- 102100035593 POU domain, class 2, transcription factor 1 Human genes 0.000 description 1
- 101710084414 POU domain, class 2, transcription factor 1 Proteins 0.000 description 1
- 108010071690 Prealbumin Proteins 0.000 description 1
- 102000007584 Prealbumin Human genes 0.000 description 1
- 102000015499 Presenilins Human genes 0.000 description 1
- 108010050254 Presenilins Proteins 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 102000002067 Protein Subunits Human genes 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 102000005622 Receptor for Advanced Glycation End Products Human genes 0.000 description 1
- 108010045108 Receptor for Advanced Glycation End Products Proteins 0.000 description 1
- PNUZDKCDAWUEGK-CYZMBNFOSA-N Sitafloxacin Chemical compound C([C@H]1N)N(C=2C(=C3C(C(C(C(O)=O)=CN3[C@H]3[C@H](C3)F)=O)=CC=2F)Cl)CC11CC1 PNUZDKCDAWUEGK-CYZMBNFOSA-N 0.000 description 1
- KEAYESYHFKHZAL-UHFFFAOYSA-N Sodium Chemical compound [Na] KEAYESYHFKHZAL-UHFFFAOYSA-N 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical class [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical group [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 102000019197 Superoxide Dismutase Human genes 0.000 description 1
- 108010012715 Superoxide dismutase Proteins 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical class [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 1
- PSLUFJFHTBIXMW-WYEYVKMPSA-N [(3r,4ar,5s,6s,6as,10s,10ar,10bs)-3-ethenyl-10,10b-dihydroxy-3,4a,7,7,10a-pentamethyl-1-oxo-6-(2-pyridin-2-ylethylcarbamoyloxy)-5,6,6a,8,9,10-hexahydro-2h-benzo[f]chromen-5-yl] acetate Chemical compound O([C@@H]1[C@@H]([C@]2(O[C@](C)(CC(=O)[C@]2(O)[C@@]2(C)[C@@H](O)CCC(C)(C)[C@@H]21)C=C)C)OC(=O)C)C(=O)NCCC1=CC=CC=N1 PSLUFJFHTBIXMW-WYEYVKMPSA-N 0.000 description 1
- QPQGTZMAQRXCJW-UHFFFAOYSA-N [chloro(phenyl)phosphoryl]benzene Chemical compound C=1C=CC=CC=1P(=O)(Cl)C1=CC=CC=C1 QPQGTZMAQRXCJW-UHFFFAOYSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 235000011054 acetic acid Nutrition 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 150000001335 aliphatic alkanes Chemical class 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 150000001336 alkenes Chemical class 0.000 description 1
- 150000001345 alkine derivatives Chemical class 0.000 description 1
- 150000001350 alkyl halides Chemical class 0.000 description 1
- 125000000304 alkynyl group Chemical group 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- FEWOUVRMGWFWIH-ILZZQXMPSA-N amyloid-beta polypeptide 40 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 FEWOUVRMGWFWIH-ILZZQXMPSA-N 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 125000003785 benzimidazolyl group Chemical group N1=C(NC2=C1C=CC=C2)* 0.000 description 1
- 125000004603 benzisoxazolyl group Chemical group O1N=C(C2=C1C=CC=C2)* 0.000 description 1
- 125000000499 benzofuranyl group Chemical group O1C(=CC2=C1C=CC=C2)* 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 125000005874 benzothiadiazolyl group Chemical group 0.000 description 1
- 125000001164 benzothiazolyl group Chemical group S1C(=NC2=C1C=CC=C2)* 0.000 description 1
- 125000004196 benzothienyl group Chemical group S1C(=CC2=C1C=CC=C2)* 0.000 description 1
- 125000004541 benzoxazolyl group Chemical group O1C(=NC2=C1C=CC=C2)* 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- UWTDFICHZKXYAC-UHFFFAOYSA-N boron;oxolane Chemical compound [B].C1CCOC1 UWTDFICHZKXYAC-UHFFFAOYSA-N 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000007894 caplet Substances 0.000 description 1
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical compound OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 210000000748 cardiovascular system Anatomy 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- JQXXHWHPUNPDRT-YOPQJBRCSA-N chembl1332716 Chemical compound O([C@](C1=O)(C)O\C=C/[C@@H]([C@H]([C@@H](OC(C)=O)[C@H](C)[C@H](O)[C@H](C)[C@@H](O)[C@@H](C)/C=C\C=C(C)/C(=O)NC=2C(O)=C3C(O)=C4C)C)OC)C4=C1C3=C(O)C=2\C=N\N1CCN(C)CC1 JQXXHWHPUNPDRT-YOPQJBRCSA-N 0.000 description 1
- 238000000262 chemical ionisation mass spectrometry Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 230000019771 cognition Effects 0.000 description 1
- 239000012230 colorless oil Substances 0.000 description 1
- 229940125844 compound 46 Drugs 0.000 description 1
- 229940125900 compound 59 Drugs 0.000 description 1
- 239000010779 crude oil Substances 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 125000000753 cycloalkyl group Chemical group 0.000 description 1
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 230000003436 cytoskeletal effect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 210000001787 dendrite Anatomy 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 150000001993 dienes Chemical class 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 150000005218 dimethyl ethers Chemical class 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- 150000002009 diols Chemical class 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 230000003086 effect on acetylcholine Effects 0.000 description 1
- 239000012039 electrophile Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- 102000015694 estrogen receptors Human genes 0.000 description 1
- 108010038795 estrogen receptors Proteins 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 239000000835 fiber Substances 0.000 description 1
- 239000000706 filtrate Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 239000012458 free base Substances 0.000 description 1
- 125000002541 furyl group Chemical group 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 150000004820 halides Chemical class 0.000 description 1
- 210000003128 head Anatomy 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 210000001320 hippocampus Anatomy 0.000 description 1
- 150000004677 hydrates Chemical class 0.000 description 1
- 150000004678 hydrides Chemical class 0.000 description 1
- 238000006197 hydroboration reaction Methods 0.000 description 1
- 125000002883 imidazolyl group Chemical group 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 125000003453 indazolyl group Chemical group N1N=C(C2=C1C=CC=C2)* 0.000 description 1
- 125000001041 indolyl group Chemical group 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 1
- 238000006317 isomerization reaction Methods 0.000 description 1
- 125000000842 isoxazolyl group Chemical group 0.000 description 1
- DWKPPFQULDPWHX-VKHMYHEASA-N l-alanyl ester Chemical compound COC(=O)[C@H](C)N DWKPPFQULDPWHX-VKHMYHEASA-N 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- MHCFAGZWMAWTNR-UHFFFAOYSA-M lithium perchlorate Chemical compound [Li+].[O-]Cl(=O)(=O)=O MHCFAGZWMAWTNR-UHFFFAOYSA-M 0.000 description 1
- 229910001486 lithium perchlorate Inorganic materials 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 230000003340 mental effect Effects 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 125000002950 monocyclic group Chemical group 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- DYGBNAYFDZEYBA-UHFFFAOYSA-N n-(cyclopropylmethyl)-2-[4-(4-methoxybenzoyl)piperidin-1-yl]-n-[(4-oxo-1,5,7,8-tetrahydropyrano[4,3-d]pyrimidin-2-yl)methyl]acetamide Chemical compound C1=CC(OC)=CC=C1C(=O)C1CCN(CC(=O)N(CC2CC2)CC=2NC(=O)C=3COCCC=3N=2)CC1 DYGBNAYFDZEYBA-UHFFFAOYSA-N 0.000 description 1
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 1
- 125000000740 n-pentyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 210000002850 nasal mucosa Anatomy 0.000 description 1
- 239000005445 natural material Substances 0.000 description 1
- 125000001971 neopentyl group Chemical group [H]C([*])([H])C(C([H])([H])[H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 210000002241 neurite Anatomy 0.000 description 1
- 230000000626 neurodegenerative effect Effects 0.000 description 1
- 210000002682 neurofibrillary tangle Anatomy 0.000 description 1
- 210000005044 neurofilament Anatomy 0.000 description 1
- 230000016273 neuron death Effects 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- LYGJENNIWJXYER-UHFFFAOYSA-N nitromethane Chemical compound C[N+]([O-])=O LYGJENNIWJXYER-UHFFFAOYSA-N 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000010502 orange oil Substances 0.000 description 1
- 239000013110 organic ligand Substances 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 125000002971 oxazolyl group Chemical group 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 125000000286 phenylethyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000004344 phenylpropyl group Chemical group 0.000 description 1
- 230000037081 physical activity Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 230000007505 plaque formation Effects 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 159000000001 potassium salts Chemical class 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- JKANAVGODYYCQF-UHFFFAOYSA-N prop-2-yn-1-amine Chemical compound NCC#C JKANAVGODYYCQF-UHFFFAOYSA-N 0.000 description 1
- TVDSBUOJIPERQY-UHFFFAOYSA-N prop-2-yn-1-ol Chemical compound OCC#C TVDSBUOJIPERQY-UHFFFAOYSA-N 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 125000003373 pyrazinyl group Chemical group 0.000 description 1
- 125000002098 pyridazinyl group Chemical group 0.000 description 1
- 150000003242 quaternary ammonium salts Chemical class 0.000 description 1
- 238000010791 quenching Methods 0.000 description 1
- 239000003642 reactive oxygen metabolite Substances 0.000 description 1
- 210000003370 receptor cell Anatomy 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 238000006722 reduction reaction Methods 0.000 description 1
- 230000001850 reproductive effect Effects 0.000 description 1
- 239000011369 resultant mixture Substances 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 229960001225 rifampicin Drugs 0.000 description 1
- 102000035013 scavenger receptor class A Human genes 0.000 description 1
- 108091005451 scavenger receptor class A Proteins 0.000 description 1
- 102000014452 scavenger receptors Human genes 0.000 description 1
- 108010078070 scavenger receptors Proteins 0.000 description 1
- 238000003345 scintillation counting Methods 0.000 description 1
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 230000001953 sensory effect Effects 0.000 description 1
- 210000001044 sensory neuron Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000012279 sodium borohydride Substances 0.000 description 1
- 229910000033 sodium borohydride Inorganic materials 0.000 description 1
- 239000012312 sodium hydride Substances 0.000 description 1
- 229910000104 sodium hydride Inorganic materials 0.000 description 1
- 239000012321 sodium triacetoxyborohydride Substances 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 235000002906 tartaric acid Nutrition 0.000 description 1
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 125000000335 thiazolyl group Chemical group 0.000 description 1
- 210000004291 uterus Anatomy 0.000 description 1
- 238000010792 warming Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D295/00—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms
- C07D295/04—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms
- C07D295/08—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly bound oxygen or sulfur atoms
- C07D295/096—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly bound oxygen or sulfur atoms with the ring nitrogen atoms and the oxygen or sulfur atoms separated by carbocyclic rings or by carbon chains interrupted by carbocyclic rings
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/135—Amines having aromatic rings, e.g. ketamine, nortriptyline
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/535—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
- A61K31/5375—1,4-Oxazines, e.g. morpholine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/02—Muscle relaxants, e.g. for tetanus or cramps
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C215/00—Compounds containing amino and hydroxy groups bound to the same carbon skeleton
- C07C215/46—Compounds containing amino and hydroxy groups bound to the same carbon skeleton having hydroxy groups bound to carbon atoms of at least one six-membered aromatic ring and amino groups bound to acyclic carbon atoms or to carbon atoms of rings other than six-membered aromatic rings of the same carbon skeleton
- C07C215/64—Compounds containing amino and hydroxy groups bound to the same carbon skeleton having hydroxy groups bound to carbon atoms of at least one six-membered aromatic ring and amino groups bound to acyclic carbon atoms or to carbon atoms of rings other than six-membered aromatic rings of the same carbon skeleton with rings other than six-membered aromatic rings being part of the carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C217/00—Compounds containing amino and etherified hydroxy groups bound to the same carbon skeleton
- C07C217/54—Compounds containing amino and etherified hydroxy groups bound to the same carbon skeleton having etherified hydroxy groups bound to carbon atoms of at least one six-membered aromatic ring and amino groups bound to acyclic carbon atoms or to carbon atoms of rings other than six-membered aromatic rings of the same carbon skeleton
- C07C217/74—Compounds containing amino and etherified hydroxy groups bound to the same carbon skeleton having etherified hydroxy groups bound to carbon atoms of at least one six-membered aromatic ring and amino groups bound to acyclic carbon atoms or to carbon atoms of rings other than six-membered aromatic rings of the same carbon skeleton with rings other than six-membered aromatic rings being part of the carbon skeleton
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C229/00—Compounds containing amino and carboxyl groups bound to the same carbon skeleton
- C07C229/02—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton
- C07C229/04—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated
- C07C229/06—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having only one amino and one carboxyl group bound to the carbon skeleton
- C07C229/10—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having only one amino and one carboxyl group bound to the carbon skeleton the nitrogen atom of the amino group being further bound to acyclic carbon atoms or to carbon atoms of rings other than six-membered aromatic rings
- C07C229/14—Compounds containing amino and carboxyl groups bound to the same carbon skeleton having amino and carboxyl groups bound to acyclic carbon atoms of the same carbon skeleton the carbon skeleton being acyclic and saturated having only one amino and one carboxyl group bound to the carbon skeleton the nitrogen atom of the amino group being further bound to acyclic carbon atoms or to carbon atoms of rings other than six-membered aromatic rings to carbon atoms of carbon skeletons containing rings
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C323/00—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups
- C07C323/23—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton
- C07C323/24—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton
- C07C323/25—Thiols, sulfides, hydropolysulfides or polysulfides substituted by halogen, oxygen or nitrogen atoms, or by sulfur atoms not being part of thio groups containing thio groups and nitrogen atoms, not being part of nitro or nitroso groups, bound to the same carbon skeleton having the sulfur atoms of the thio groups bound to acyclic carbon atoms of the carbon skeleton the carbon skeleton being acyclic and saturated
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D295/00—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms
- C07D295/04—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms
- C07D295/08—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly bound oxygen or sulfur atoms
- C07D295/084—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly bound oxygen or sulfur atoms with the ring nitrogen atoms and the oxygen or sulfur atoms attached to the same carbon chain, which is not interrupted by carbocyclic rings
- C07D295/088—Heterocyclic compounds containing polymethylene-imine rings with at least five ring members, 3-azabicyclo [3.2.2] nonane, piperazine, morpholine or thiomorpholine rings, having only hydrogen atoms directly attached to the ring carbon atoms with substituted hydrocarbon radicals attached to ring nitrogen atoms substituted by singly bound oxygen or sulfur atoms with the ring nitrogen atoms and the oxygen or sulfur atoms attached to the same carbon chain, which is not interrupted by carbocyclic rings to an acyclic saturated chain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D333/00—Heterocyclic compounds containing five-membered rings having one sulfur atom as the only ring hetero atom
- C07D333/02—Heterocyclic compounds containing five-membered rings having one sulfur atom as the only ring hetero atom not condensed with other rings
- C07D333/04—Heterocyclic compounds containing five-membered rings having one sulfur atom as the only ring hetero atom not condensed with other rings not substituted on the ring sulphur atom
- C07D333/06—Heterocyclic compounds containing five-membered rings having one sulfur atom as the only ring hetero atom not condensed with other rings not substituted on the ring sulphur atom with only hydrogen atoms, hydrocarbon or substituted hydrocarbon radicals, directly attached to the ring carbon atoms
- C07D333/14—Radicals substituted by singly bound hetero atoms other than halogen
- C07D333/20—Radicals substituted by singly bound hetero atoms other than halogen by nitrogen atoms
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07F—ACYCLIC, CARBOCYCLIC OR HETEROCYCLIC COMPOUNDS CONTAINING ELEMENTS OTHER THAN CARBON, HYDROGEN, HALOGEN, OXYGEN, NITROGEN, SULFUR, SELENIUM OR TELLURIUM
- C07F9/00—Compounds containing elements of Groups 5 or 15 of the Periodic System
- C07F9/02—Phosphorus compounds
- C07F9/28—Phosphorus compounds with one or more P—C bonds
- C07F9/30—Phosphinic acids R2P(=O)(OH); Thiophosphinic acids, i.e. R2P(=X)(XH) (X = S, Se)
- C07F9/32—Esters thereof
- C07F9/3258—Esters thereof the ester moiety containing a substituent or a structure which is considered as characteristic
- C07F9/3282—Esters with hydroxyaryl compounds
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C2602/00—Systems containing two condensed rings
- C07C2602/02—Systems containing two condensed rings the rings having only two atoms in common
- C07C2602/04—One of the condensed rings being a six-membered aromatic ring
- C07C2602/10—One of the condensed rings being a six-membered aromatic ring the other ring being six-membered, e.g. tetraline
Definitions
- the present invention provides a method for treating neurodegenerative disorders. More particularly, a method for treating neurodegenerative disorders (e.g., Alzheimer's disease) by inhibiting the interaction of amyloid beta with alpha-7 nicotinic acetylcholine receptors.
- a method for treating neurodegenerative disorders e.g., Alzheimer's disease
- amyloid beta with alpha-7 nicotinic acetylcholine receptors.
- AD Alzheimer's disease
- PD Parkinson's disease
- AD is characterized by neurofibrillary tangles, neuritic plaques, and neuronal cell death.
- AD appears as either the familial, early onset ( ⁇ 60 yrs) or late-onset (>60 yrs) forms, with the latter being more prevalent.
- AD is the major cause of age-related dementia and cognitive impairment (Wisniewski, T.; Ghiso, J.; Frangione, B. Neurobiol. of Disease 1997, 4, 313-328).
- amyloid precursor protein APP
- a ⁇ 1-40 ⁇ -amyloid 1-40
- a ⁇ 1-42 ⁇ -amyloid 1-42
- the A ⁇ peptides are derived from APP by proteolytic processing. Dramatic evidence implicating the A ⁇ peptides, particularly A ⁇ 1-42 , in AD comes from various recently identified mutations accounting for certain types of inherited AD. Such mutations in the presenilin (PS1 and PS2) genes are probably the cause of the most frequent form of familial, early-onset AD (Rogaev, E. I. Molecular Biology 1998, 32, 58). In these cases, as with APP mutations, more A ⁇ 1-42 is observed relative to A ⁇ 1-40 .
- PS1 and PS2 presenilin
- a ⁇ 1-42 has a greater ability than A ⁇ 1-40 to aggregate into the amyloid fibrils that constitute the plaques characteristic of AD (Lansbury, P. T., Jr. Accts. Chem. Res. 1996, 29, 317). Even though A ⁇ 1-40 is generally present to a much larger degree in the cerebrospinal fluid than A ⁇ 1-42 , it is A ⁇ 1-42 which is the major A ⁇ peptide found in AD plaques.
- a ⁇ peptides can inhibit cholinergic neurotransmitter function independent of neurotoxicity (Auld, D. S.; Kar, S.; Quirion, R. Trends Neurosci. 1998, 21, 43).
- a ⁇ peptides bind to a number of natural substances such as apoE3, apoE4, apoJ, transthyretin, and albumin.
- a ⁇ has been reported to interact with a membrane-bound receptor for advanced glycation end products and to the class A scavenger receptor (SR) associated with the production of reactive oxygen species.
- SR scavenger receptor
- nAChRs nicotinic acetylcholine receptors
- nAChRs are members of the ligand-gated ion channel family and appear to be formed from five protein subunits associating together around a central pore (Lindstrom, J. Molecular Neurobiology 1997, 15, 193). These subunits include ⁇ 1- ⁇ 9, ⁇ 1- ⁇ 4, ⁇ , ⁇ , and ⁇ .
- the ⁇ 7 subtype forms functional homomers which bind to ⁇ -bungarotoxin, a 75-amino acid peptide, with high affinity (0.65-1.7 nM K d ) and nicotine with relatively low affinity (ca. micromolar K d ) (Holladay, M. W.; Dart, M. J.; Lynch, J. K. J. Med. Chem. 1997, 40, 4169).
- Compounds which block the aggregation of A ⁇ peptides are potentially useful drugs for the treatment of AD.
- rifampicin inhibits A ⁇ aggregation and neurotoxicity and may show an effect in vivo in diminishing plaque burden when compared with age-matched controls (Tomiyama, T. et al. J. Biol. Chem. 1996, 271, 6839).
- compounds can be found to either bind to ⁇ 7 nAChRs, to A ⁇ itself, or to both.
- a ⁇ 1-42 to alpha-7 nAChRs provides a seed for crystallization or deposition of A ⁇ into insoluble deposits, which have the potential to grow into the fibrillar amyloid deposits characteristic of AD. Therefore, blocking the interaction of A ⁇ 1-42 with alpha-7 nAChRs should reduce the amount of insoluble aggregated A ⁇ that is formed, and thus prevent the neurotoxicity and pathology associated with such aggregated amyloid deposits.
- the present invention is directed to a method of treating a neurodegenerative disorder in a subject (preferably, a human) in need thereof which comprises administering to the subject an amount of a compound effective to inhibit the binding of an amyloid beta peptide, preferably A ⁇ 1-42 , to alpha-7 nAChRs, preferably, human alpha-7 nAChRs. Since alpha-8 and alpha-9 nAChRs are similar with respect to structure and function to alpha-7 nAChRs, it is possible that blocking the interaction of ⁇ -amyloid with alpha-8 and alpha-9 nAChRs would have therapeutic benefit as well.
- Neurodegenerative disorders included within the methods of the present invention include, but are not limited to, Alzheimer's disease, Pick's disease, diffuse Lewy body disease, progressive supranuclear palsy (Steel-Richardson syndrome), multisystem degeneration (Shy-Drager syndrome), motor neuron diseases including amyotrophic lateral sclerosis, degenerative ataxias, cortical basal degeneration, ALS-Parkinson's-Dementia complex of Guam, subacute sclerosing panencephalitis, Huntington's disease, Parkinson's disease, synucleinopathies, primary progressive aphasia, striatonigral degeneration, Machado-Joseph disease/spinocerebellar ataxia type 3 and olivopontocerebellar degenerations, Gilles De La Tourette's disease, bulbar and pseudobulbar palsy, spinal and spinobulbar muscular atrophy (Kennedy's disease), primary lateral sclerosis, familial
- Other conditions also included within the methods of the present invention include age-related dementia and other dementias and conditions with memory loss including vascular dementia, diffuse white matter disease (Binswanger's disease), dementia of endocrine or metabolic origin, dementia of head trauma and diffuse brain damage, dementia pugilistica and frontal lobe dementia. Also other neurodegenerative disorders resulting from cerebral ischemia or infaction including embolic occlusion and thrombotic occlusion as well as intracranial hemorrhage of any type (including, but not limited to, epidural, subdural, subarachnoid and intracerebral), and intracranial and intravertebral lesions (including, but not limited to, contusion, penetration, shear, compression and laceration).
- vascular dementia diffuse white matter disease (Binswanger's disease)
- dementia of endocrine or metabolic origin dementia of head trauma and diffuse brain damage
- dementia pugilistica and frontal lobe dementia dementia pugilistica and frontal lobe dementia.
- the neurodegenerative disorder is selected from Alzheimer's disease, Parkinson's disease, Tourette's syndrome, amyotrophic lateral sclerosis, age-related memory loss, senility and age-related dementia, most preferably, the neurodegenerative disorder is Alzheimer's disease.
- the neurodegenerative disorder is Alzheimer's disease, also defined as an amyloidosis
- other conditions within the methods of the present invention include other amyloidosis which share features including, but not limited to, hereditary cerebral angiopathy, nonneuropathic hereditary amyloid, Down's syndrome, macroglobulinemia, secondary familial Mediterranean fever, Muckle-Wells syndrome, multiple myeloma, pancreatic- and cardiac-related amyloidosis, chronic hemodialysis arthropathy, and Finnish and Iowa amyloidosis.
- In one embodiment of the invention is a method of treating and/or preventing dementia in an Alzheimer's patient (as well as a method for treating and/or preventing other clinical manifestations of Alzheimer's disease that include, but are not limited to, cognitive and language deficits, apraxias, depression, delusions and other neuropsychiatric symptoms and signs, and movement and gait abnormalities) which comprises administering to the subject a therapeutically effective amount of a compound to inhibit the binding of an amyloid beta peptide (preferably, A ⁇ 1-42 ) with nAChRs, preferable alpha-7 nAChRs, most preferably, human alpha-7 nAChRs.
- an amyloid beta peptide preferably, A ⁇ 1-42
- a second embodiment of the invention is a method of improving memory and/or mental status and/or of halting the progression of mental deterioration in an Alzheimer's disease patient which comprises administering to the subject a therapeutically effective amount of a compound to inhibit the binding of an amyloid beta peptide (preferably, A ⁇ - 1-42 ) with nAChRs, preferably alpha-7 nAChRs, most preferably, human alpha-7 nAChRs.
- an amyloid beta peptide preferably, A ⁇ - 1-42
- nAChRs preferably alpha-7 nAChRs, most preferably, human alpha-7 nAChRs.
- the compound used in the methods of treating neurodegenerative disorders, treating and/or preventing Alzheimer's disease, and improving memory and/or halting the progression of mental deterioration in an Alzheimer's disease patient is not estrogen, raloxifene, droloxifene, tamoxifen, idoxifene or levomeloxifene; more preferably, the compound is not estrogen or a selective estrogen receptor modulator (SERM).
- SERM is an estrogen receptor ligand that exhibits estrogen agonist activity in the cardiovascular system, CNS and bone, and estrogen antagonist activity in reproductive tissues, such as breast and uterus.
- Also included in the invention is the use of a compound which inhibits the binding of an amyloid beta peptide (preferably A ⁇ 1-42 ) to an alpha-7 nAChR (preferably, a human alpha-7 nAChR) in the preparation of a medicament for the treatment of a neurodegenerative disorder in a subject (preferably, a human) in need thereof.
- an amyloid beta peptide preferably A ⁇ 1-42
- an alpha-7 nAChR preferably, a human alpha-7 nAChR
- Another illustration of the invention is the use of a compound which inhibits the binding of an amyloid beta peptide (preferably A ⁇ 1-42 ) to alpha-7 nAChRs (preferably, human alpha-7 nAChRs) in the preparation of a medicament for: a) improving memory, b) halting the progression of the mental deterioration seen in Alzheimer's disease patients, c) treating dementia, d) preventing dementia in an Alzheimer's patient, and e) treating and/or preventing other clinical manifestations of Alzheimer's disease that include, but are not limited to, cognitive and language deficits, apraxias, depression, delusions and other neuropsychiatric symptoms and signs, and movement and gait abnormalities in an Alzheimer's patient.
- an amyloid beta peptide preferably A ⁇ 1-42
- alpha-7 nAChRs preferably, human alpha-7 nAChRs
- R 1 is hydrogen or C 1 -C 4 alkyl
- R 2 is selected from hydrogen, C 1 -C 6 alkyl, aryl or C 7 -C 10 aralkyl;
- R 3 is selected from hydrogen, C 1 -C 6 alkyl, C 3 -C 10 alkenyl, C 3 -C 8 cycloalkylC 1 -C 6 alkyl, C 1 -C 6 alkoxycarbonylC 1 -C 6 alkyl, C 1 -C 6 alkylthio, heteroarylC 1 -C 4 alkyl, unsubstituted or substituted aryl or unsubstituted or substituted C 7 -C 10 aralkyl wherein the substituent on the aryl or aralkyl are one or more substituents independently selected from the group consisting of halogen, hydroxy, C 1 -C 6 alkyl and unsubstituted or substituted C 1 -C 6 alkoxy wherein the substituents on the alkoxy are one or more substituents independently selected from amino, C 1 -C 6 alkylamino, C 1 -C 6 dialkylamino, pyrrolidinyl,
- R 4 is C 1 -C 6 alkyl, aryl, or C 7 -C 10 aralkyl
- R 5 and R 6 are each independently selected from hydrogen, C 1 -C 6 alkyl, C 3 -C 10 alkenyl, C 1 -C 8 alkylcarbonyl, or diphenylphosphinyl; and pharmaceutically acceptable salts and prodrugs thereof.
- R 1 is hydrogen
- R 2 is selected from hydrogen or C 1 -C 4 alkyl
- R 3 is selected from C 1 -C 4 alkyl, C 3 -C 10 alkenyl, C 5 -C 6 cycloalkylC 1 -C4 6 alkyl, C 1 -C 6 alkoxycarbonylC 1 -C 4 alkyl, C 1 -C 6 alkylthio, heteroarylC 1 -C 4 alkyl, or unsubstituted or substituted C 7 -C 10 aralkyl wherein the substituent on the aralkyl are one or two substituents independently selected from the group consisting of halogen, hydroxy, C 1 -C 4 alkyl and unsubstituted or substituted C 1 -C 4 alkoxy wherein the substituents on the alkoxy are one or two substituents independently selected from amino, C 1 -C 4 alkylamino, C 1 -C 4 dialkylamino, pyrrolidinyl, or piperidinyl; or
- R 4 is C 1 -C 4 alkyl
- R 5 and R 6 are each independently selected from hydrogen, C 1 -C 4 alkyl, C 3 -C 6 alkenyl, C 1 -C 6 alkylcarbonyl, or diphenylphosphinyl.
- R 1 is hydrogen or C 1 -C 4 alkyl
- R 2 and R 3 are each independently selected from hydrogen, C 1 -C 6 alkyl, aryl or C 7 -C 10 aralkyl;
- R 4 is C 1 -C 6 alkyl, aryl, or C 7 -C 10 aralkyl
- Compounds of formula I are novel compounds which block the interaction of beta-amyloid with alpha- 7 nAChRs. More specifically, the compounds of formula I inhibit the binding of A ⁇ 1-42 with human alpha- 7 nAChRs by binding to A ⁇ 1-42 .
- the orientation between the nitrogen atom and R 4 on the appropriate ring can be either cis or trans.
- the compound is 5,8-dihydroxy-trans-2-di(N-propylamino)-3-methyl-1,2,3,4-tetrahydronaphthalene, and pharmaceutically acceptable salts thereof.
- the present invention provides methods of treating neurodegenerative disorders by inhibiting the binding of amyloid beta peptides to alpha-7 nAChRs.
- Neurodegenerative disorders included within the methods of the present invention include, but are not limited to, Alzheimer's disease, Pick's disease, diffuse Lewy body disease, progressive supranuclear palsy (Steel-Richardson syndrome), multisystem degeneration (Shy-Drager syndrome), motor neuron diseases including amyotrophic lateral sclerosis, degenerative ataxias, cortical basal degeneration, ALS-Parkinson's-Dementia complex of Guam, subacute sclerosing panencephalitis, Huntington's disease, Parkinson's disease, synucleinopathies, primary progressive aphasia, striatonigral degeneration, Machado-Joseph disease/spinocerebellar ataxia type 3 and olivopontocerebellar degenerations, Gilles De La Tourette's disease, bulb
- Other conditions also included within the methods of the present invention include age-related dementia and other dementias and conditions with memory loss including vascular dementia, diffuse white matter disease (Binswanger's disease), dementia of endocrine or metabolic origin, dementia of head trauma and diffuse brain damage, dementia pugilistica and frontal lobe dementia. Also other neurodegenerative disorders resulting from cerebral ischemia or infaction including embolic occlusion and thrombotic occlusion as well as intracranial hemorrhage of any type (including, but not limited to, epidural, subdural, subarachnoid and intracerebral), and intracranial and intravertebral lesions (including, but not limited to, contusion, penetration, shear, compression and laceration).
- vascular dementia diffuse white matter disease (Binswanger's disease)
- dementia of endocrine or metabolic origin dementia of head trauma and diffuse brain damage
- dementia pugilistica and frontal lobe dementia dementia pugilistica and frontal lobe dementia.
- the neurodegenerative disorder is selected from Alzheimer's disease, Parkinson's disease, Tourette's syndrome, amyotrophic lateral sclerosis, age-related memory loss, senility and age-related dementia, most preferably, the neurodegenerative disorder is Alzheimer's disease.
- the neurodegenerative disorder is Alzheimer's disease, also defined as an amyloidosis
- other conditions within the methods of the present invention include other amyloidosis which share features including, but not limited to, hereditary cerebral angiopathy, nonneuropathic hereditary amyloid, Down's syndrome, macroglobulinemia, secondary familial Mediterranean fever, Muckle-Wells syndrome, multiple myeloma, pancreatic- and cardiac-related amyloidosis, chronic hemodialysis arthropathy, and Finnish and Iowa amyloidosis.
- amyloid beta refers to amyloid beta peptides and include the A ⁇ 1-40 , A ⁇ 1-42 and A ⁇ 1-43 peptides and their fragments.
- fragments of amyloid beta peptides include, but not limited to, fragment 1-28, and fragment 25-35 (e.g., Yatin S M, Aksenov M, Butterfield D A. Neurochem Res 1999 Mar;24(3):427-35; Hirakura Y, Satoh Y, Hirashima N, Suzuki T, Kagan B L, Kirino Y.
- subject refers to an animal, preferably a mammal, most preferably a human, who has been the object of treatment, observation or experiment.
- terapéuticaally effective amount means that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human that is being sought by a researcher, veterinarian, medical doctor or other clinician, which includes alleviation of the symptoms of the disease or disorder being treated.
- alkyl shall mean straight or branched chain alkanes of one to ten carbon atoms, or any number within this range.
- alkyl radicals include, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, t-butyl, n-pentyl, 3-(2-methyl)butyl, 2-pentyl, 2-methylbutyl, neopentyl, n-hexyl, 2-hexyl and 2-methylpentyl.
- Alkoxy radicals are oxygen ethers formed from the previously described straight or branched chain alkyl groups.
- Cycloalkyl groups contain 3 to 8 ring carbons and preferably 5 to 7 carbons.
- alkenyl and alkynyl groups include straight and branched chain alkenes and alkynes having 2 to 10 carbon atoms, or any number within this range.
- aryl indicates aromatic groups such as phenyl and naphthyl.
- C 7 -C 10 aralkyl means an alkyl group substituted with an aryl group wherein the total number of carbon atoms is between 7 and 10 (e.g., benzyl, phenylethyl, phenylpropyl).
- heteroaryl represents an unsubstituted or substituted stable five or six membered monocyclic aromatic ring system or an unsubstituted or substituted nine or ten membered benzo-fused heteroaromatic ring system or bicyclic heteroaromatic ring system which consists of carbon atoms and from one to four heteroatoms selected from N, O or S, and wherein the nitrogen or sulfur heteroatoms may optionally be oxidized, and the nitrogen heteroatom may optionally be quaternized.
- the heteroaryl group may be attached at any heteroatom or carbon atom that results in the creation of a stable structure.
- heteroaryl groups include, but are not limited to pyridyl, pyridazinyl, thienyl, furanyl, imidazolyl, isoxazolyl, oxazolyl, pyrazolyl, pyrrolyl, thiazolyl, thiadiazolyl, triazolyl, benzimidazolyl, benzofuranyl, benzothienyl, benzisoxazolyl, benzoxazolyl, benzopyrazolyl, indolyl, benzothiazolyl, benzothiadiazolyl, benzotriazolyl adeninyl or quinolinyl.
- Prefered heteroaryl groups include pyridyl, pyrrolyl, pyrazinyl, thiadiazolyl, pyrazolyl, thienyl, triazolyl and quinolinyl.
- N(CH 2 ) 5 means a piperidinyl group.
- cC 6 H 11 refers to a cyclohexyl group.
- a particular group is “substituted” (e.g., aryl, aralkyl)
- that group may have one or more substituents, preferably from one to five substituents, more preferably from one to three substituents, most preferably from one to two substituents, independently selected from the list of substituents.
- a “phenylC 1 -C 6 alkylamidoC 1 -C 6 alkyl” substituent refers to a group of the formula
- Compounds which are useful in the methods of the present invention for inhibiting the interaction of A ⁇ 1-40 and A ⁇ 1-42 to the alpha-7 subtype of nAChRs for either the purpose of direct therapeutic intervention or in order to screen for compounds which act via this mechanism include compounds of formula I, especially 5,8-dihydroxy-trans-2-di(N-propylamino)-3-methyl-1,2,3,4-tetrahydronaphthalene (Compound 9), ( ⁇ )-nicotine, (rac)-epibatidine, ⁇ -bungarotoxin, and pharmaceutically acceptable salts thereof.
- Certain peptide stretches of the human alpha-7 nAChR bind to amyloid beta and can be used in place of the alpha-7 nAChR together with amyloid beta for the purpose of screening libraries to find compounds which block the interaction of amyloid beta and the human alpha-7 nAChR. Included among these peptide stretches of the human alpha-7 nAChR are alpha-7 nAChR193-224 and smaller peptides derived thereof as listed in the Table.
- the salts of the compounds of this invention refer to non-toxic “pharmaceutically acceptable salts.” Other salts may, however, be useful in the preparation of compounds according to this invention or of their pharmaceutically acceptable salts.
- Suitable pharmaceutically acceptable salts of the compounds of this invention include acid addition salts which may, for example, be formed by mixing a solution of the compound with a solution of a pharmaceutically acceptable acid such as hydrochloric acid, sulfuric acid, fumaric acid, maleic acid, succinic acid, acetic acid, benzoic acid, citric acid, tartaric acid, carbonic acid or phosphoric acid.
- suitable pharmaceutically acceptable salts thereof may include alkali metal salts, e.g., sodium or potassium salts; alkaline earth metal salts, e.g., calcium or magnesium salts; and salts formed with suitable organic ligands, e.g., quaternary ammonium salts.
- alkali metal salts e.g., sodium or potassium salts
- alkaline earth metal salts e.g., calcium or magnesium salts
- suitable organic ligands e.g., quaternary ammonium salts.
- the present invention includes within its scope prodrugs of the compounds of this invention.
- a prodrug is inactive as administered, but becomes activated in vivo.
- the prodrug is converted to the parent drug chemically or by specific enzyme(s).
- prodrugs will be functional derivatives of the compounds which are readily convertible in vivo into the required compound.
- the term “administering” shall encompass the treatment of the various disorders described with the compound specifically disclosed or with a compound which may not be specifically disclosed, but which converts to the specified compound in vivo after administration to the patient.
- Conventional procedures for the selection and preparation of suitable prodrug derivatives are described, for example, in “Design of Prodrugs”, ed. H. Bundgaard, Elsevier, 1985.
- the compounds according to this invention may accordingly exist as enantiomers. Where the compounds possess two or more chiral centers, they may additionally exist as diastereomers. It is to be understood that all such isomers and mixtures thereof are encompassed within the scope of the present invention. Furthermore, some of the crystalline forms for the compounds may exist as polymorphs and as such are intended to be included in the present invention. In addition, some of the compounds may form solvates with water (i.e., hydrates) or common organic solvents, and such solvates are also intended to be encompassed within the scope of this invention.
- ( ⁇ )-Nicotine is ( ⁇ )-1-methyl-2-(3-pyridinyl)pyrrolidine and is readily available from Sigma Chemical Company.
- (+/ ⁇ )-Epibatidine is exo-(+/ ⁇ )-2-(6-chloro-3-pyridinyl)-7-azabicyclo[2.2.1]heptane and is readily available from Sigma Chemical Company.
- ⁇ -Bungarotoxin is a 74 amino acid peptide which is commercially available from Research Biochemicals Inc. ⁇ -Bungarotoxin and its amino acid sequence are described in Lee, C. Y. Annu. Rev. Pharmacol. 1972, 12, 265-281.
- 125 I-A ⁇ 1-40 , fluo-A ⁇ 1-40 , and anti-alpha-7 nAChR antibodies are commercially available Amersham Pharmacia Biotech, Advanced Bioconcepts and Research Biochemicals International, respectively.
- 125 I- ⁇ -bungarotoxin is commercially available from Amersham Pharmacia Biotech.
- the present invention therefore provides a method of treating a neurodegenerative disorder, which comprises administering any of the compounds as defined herein in a quantity effective to treat the neurodegenerative disorder.
- the compound is not estrogen, raloxifene, droloxifene, tamoxifen, idoxifene or levomeloxifene; more preferably, the compound is not estrogen or a selective estrogen receptor modulator (SERM).
- SERM selective estrogen receptor modulator
- the compound may be administered to a patient afflicted with a neurodegenerative disorder by any conventional route of administration, including, but not limited to, intravenous, oral, subcutaneous, intramuscular, intradermal, buccal, intracerebral and other parenteral routes.
- the quantity of the compound which is effective for treating a neurodegenerative disorder is between 0.01 mg per kg and 10 mg per kg of subject body weight.
- the method of treating neurodegenerative disorders described in the present invention may also be carried out using a pharmaceutical composition
- a pharmaceutical composition comprising any of the compounds as defined herein and a pharmaceutically acceptable carrier.
- the pharmaceutical composition may contain between about 0.5 mg and 200 mg of the compound, and may be constituted into any form suitable for the mode of administration selected.
- Carriers include necessary and inert pharmaceutical excipients, including, but not limited to, binders, suspending agents, lubricants, flavorants, sweeteners, preservatives, dyes, and coatings.
- Compositions suitable for oral administration include solid forms, such as pills, capsules, granules, tablets, caplets, and powders, and liquid forms, such as solutions, syrups, elixers, and suspensions.
- Forms useful for intracerebral and other parenteral routes of administration include sterile solutions, emulsions and suspensions.
- Optimal dosages to be administered may be readily determined by those skilled in the art, and will vary with the particular compound used, the mode of administration, the strength of the preparation, the mode of administration, and the advancement of the disease condition. In addition, factors associated with the particular patient being treated, including patient age, body weight, diet, physical activity and time of administration, and associated co-morbidities and clinical conditions will result in the need to adjust dosages.
- the present invention also provides diagnostic tools useful for diagnosing Alzheimer's disease.
- Alzheimer's disease exhibits neuropathological abnormalities in the olfactory system located in the nasal cavity. These include the presence of dystrophic neurites that exhibit immunoreactivity for tau, neurofilaments, apolipoprotein E and other proteins, abnormal tau protein, increase in superoxide dismutase, and beta-amyloid deposition in the primary sensory (olfactory receptor) cells and nerve fibres of the nasal mucosa tissue (Arnold et al., Ann N Y Acad Sci 1998 Nov 30;855:762-75; Hock et al., Eur Neurol 1998 Jul;40(1):31-6; Johnson et al., Neurobiol Aging 1994 Nov-Dec; 15(6):675-80; Kulkarni-Narla et al., Exp Neurol 1996 Aug;140(2):115-25; Lee et al., Exp Neurol 1993 May;121(1):93-105; Tab
- AD patients e.g., central nervous system neurons from AD patients.
- Routine access to these sensory neurons and fibers can be done with nasal biopsy in AD patients (e.g., Feron et al., Arch Otolaryngol Head Neck Surg 1998 Aug;124(8):861-6).
- Olfactory neuroblasts olfactory neurons obtained by biopsy and placed in primary cell culture
- AD patients produce carboxy terminal amyloid precursor protein (APP) fragments that contain beta-amyloid (A-beta)(Crino et al., Ann Otol Rhinol Laryngol 1995 Aug;104(8):655-61).
- Crino et al. showed labeling of A-beta in the basal third of the olfactory neuroepithelium and in axons projecting through the lamina intestinal of AD patients.
- Thioflavin-S staining that detects amyloid deposition was also observed in the basal third of the olfactory neuroepithelium from AD patients.
- Alpha 7 nicotinic acetylcholine receptors are present in olfactory neurons probably including olfactory receptor cells in the nasal cavity (Alkondon et al., Neurosci Lett 1994 Aug 1;176(2):152-6; Alkondon et al., Eur J Neurosci 1997 Dec;9(12):2734-42; Bouvet et al., Neurosci Res 1988 Feb;5(3):214-23; Edwards et al., Experientia 1987 Aug 15;43(8):868-73; Edwards et al., Experientia 1988 Mar 15;44(3):208-11; Seguela et al., J Neurosci 1993 Feb;13(2):596-604).
- Beta-amyloid peptide increases cytosolic-free Ca 2+ in AD lymphoblasts (Ibarreta et al., Alzheimer Dis Assoc Disord 1997 Dec;11(4):220-7), and elevates mitogen-induced Ca 2+ responses in freshly prepared human lymphocytes (Eckert et al., Life Sci 1994;55(25-26):2019-29).
- Amyloid precursor protein can be induced on the cell surface of human lymphocytes upon stimulation (Bullido et al., Biochim Biophys Acta 1996 Aug 21;1313(1):54-62) and increased APP-770 isoform occurs in lymphocytes from AD patients (Ebstein et al., Brain Res Mol Brain Res 1996 Jan;35(1-2):260-8). Lymphoblastoid cells from patients with early-onset and late-onset familial AD show increased expression of beta-APP mRNA and protein (Matsumoto et al., Eur J Biochem 1993 Oct 1;217(1):21-7). Lymphocytes from AD patients also exhibit an increased mRNA level for alpha 7 nicotinic receptor (Hellstrom-Lindahl et al., Brain Res Mol Brain Res 1999 Mar 20;66(1-2):94-103)
- AD alpha 7 nicotinic acetylcholine receptor—beta amyloid peptides interaction in circulating blood cells and olfactory neuroepithelial neurons/neuronal processes or olfactory neuroblasts obtained from AD patients could be used as AD diagnostic tools, markers of AD progression and prognosis, and markers of therapeutic efficacy for any intervention or treatment targeting AD.
- the present invention provides methods for diagnosing Alzheimer's disease, monitoring the progression and prognosis of Alzheimer's disease and/or monitoring the therapeutic efficacy of any intervention or treatment of Alzheimer's disease comprising:
- test sample comprises circulating blood cells and/or olfactory neuroepithelial neuronal cell bodies or their neuronal processes (i.e., dendrites and axon of a nueron); and
- amyloid beta peptide including, but not limited to, A ⁇ 1-40 , A ⁇ 1-42 and A ⁇ 1-43 peptides and their fragments
- alpha-7 nicotinic acetylcholine receptors alpha-7 nicotinic acetylcholine receptors
- BSA bovine serum albumin
- FCS fetal calf serum
- nAChR nicotinic acetylcholine receptor
- PCC pyridinium chlorochromate
- TEA triethyl amine
- This material can then be subjected to a reductive amination reaction such as with propionaldehyde as shown to yield (8).
- Compound (8) is then treated with HBr in acetic acid to cleave the methyl ethers and form dihydroxy compound (9).
- BBr 3 may be used to cleave the methyl ethers and form dihydroxy compound (9).
- a deficiency of BBr 3 may be used to provide compounds in which only one of the methyl ethers has been removed to afford compounds with one hydroxy and one methoxy group.
- a further means of preparing compounds of the present invention is illustrated in Scheme 2.
- This material is then subjected to an aminomercuration reaction to afford a 2-amino-1,4-butadiene such as compound (12).
- Diels-Alder reaction of compound (12) with benzophenone (1) gives (13) which can be isomerized as in Scheme 1 with base to give the 1,5-dihyroxy compound (14).
- Compounds of type 9 can be treated with a base such as triethylamine in a suitable solvent such as dioxane or methylene chloride along with electrophiles such as acid halides, phosphinyl halides, or alkyl halides to give the products of substitution on one or both of the phenolic hydroxyls.
- a base such as triethylamine
- a suitable solvent such as dioxane or methylene chloride
- electrophiles such as acid halides, phosphinyl halides, or alkyl halides
- Ketone 6 (0.299 g, 1.36 mmol) was dissolved in toluene (1 mL) followed by the addition of morpholine (0.130 g, 0.13 mL, 1.5 mmol) and Ti(i-PrO) 4 (0.611 g, 0.64 mL, 2.15 mmol). The reaction mixture was stirred for 15 hrs at room temperature. Methanol (2 mL) was added followed by portionwise addition of NaBH 4 (0.15 g, 3.9 mmol) over 1 hr. Dichloromethane and 1N NaOH were added with thorough mixing and the organic layer was separated, dried with MgSO 4 , filtered and evaporated to an oil. Purification of this material using flash chromatography (flash silica, 75/25:hexane/EtOAc) afforded product 23.
- Ketone 6 (1 g, 4.5 mmol) was dissolved in acetonitrile (75 mL) followed by the addition of acetic acid (0.54 mL, 9 mmol, 2 eq.) and propargylamine (0.6 mL, 9 mmol, 2 eq.). The reaction mixture was stirred at room temperature for 1 hr. Sodium cyanoborohydride (0.6 g, 9 mmol, 2 eq.) was added portionwise (3 ⁇ ) over 1.5 hrs (every 30 min), and the reaction mixture was stirred overnight at room temperature. Ethyl acetate and 1 N NaOH were added with thorough mixing and the organic layer was separated, dried with MgSO 4 , filtered and evaporated to an oil.
- acetic acid (0.54 mL, 9 mmol, 2 eq.
- propargylamine 0.6 mL, 9 mmol, 2 eq.
- Ketone 6 (1 g, 4.5 mmol) was dissolved in acetonitrile (75 mL) and acetic acid (0.54 mL, 9 mmol, 2 eq.), and alanine methyl ester hydrochloride (1.3 g, 9 mmol, 2 eq.) was added. The reaction was stirred at room temperature for 1 hr, and then sodium cyanoborohydride (0.6 g, 9 mmol, 2 eq.) was added portionwise (3 ⁇ ) over 1.5 hrs (every 30 min). The reaction was stirred overnight at room temperature.
- composition 100 mg of Compound 9 from Example 1 is formulated with sufficient finely divided lactose to provide a total amount of 580 to 590 mg to fill a size O hard gel capsule.
- SK-N-MC cell membranes were incubated with 0.5 nM of 125 I- ⁇ -bungarotoxin in the presence of various concentrations of A ⁇ 1-42 and A ⁇ 1-40 at 25° C. for 1 hr. The assay mixture was then rapidly filtered and the radioactivity that was retained on the filter was determined.
- a ⁇ 1-42 Binding to Alpha-7 nAChRs is Supported by Competitive Binding Experiments with 125 I-A ⁇ 1-40 and Provides a Seed for Amyloid Deposition and, thus, Incipient Plaque Formation
- Alpha-7 nAChRs were immobilized on wheat germ agglutinin coupled yittrium SPA beads and allowed to incubate with 125 I-A ⁇ 1-40 in the presence of various concentrations of cold A ⁇ 1-40 or A ⁇ 1-42 .
- the data showed that 0.1 femtoM of cold A ⁇ 1-42 completely abolished the binding, suggesting that A ⁇ 1-42 interacted with alpha-7 nAChRs with high affinity.
- the total binding of 125 I-A ⁇ 1-40 to alpha-7 nAChRs was dramatically increased.
- a ⁇ 1-42 Binding to Alpha-7 nAChRs is of Higher Affinity than A ⁇ 1-40 Binding to Alpha-7 nAChRs
- Alpha-7 nAChRs were allowed to interact with A ⁇ 1-40 or A ⁇ 1-42 and the mixture was then immunoprecipitated with anti-alpha-7 nAChR antibodies.
- Western analyses of the immunoprecipitated proteins identified only the presence of A ⁇ 1-42 , indicating that the A ⁇ 1-42 /alpha-7 nAChR interaction is robust and of high affinity. Since it has already been shown that A ⁇ 1-40 binds to the alpha-7 receptor, the failure in detecting A ⁇ 1-40 in this co-precipitation experiment suggests that the A ⁇ 1-40 /alpha-7 nAChR interaction is of lower affinity than the A ⁇ 1-42 /alpha-7 nAChR interaction.
- a ⁇ s are known to form aggregates leading to the formation of amyloid plaques that are characteristic of Alzheimer'disease. This phenomenon can be demonstrated in vitro by using Synthaloid plates, coated with A ⁇ crystallization centers, and labelled A ⁇ s for detecting aggregation. We have validated this aggregation assay using both 125 I-A ⁇ 1-40 and fluo-A ⁇ 1-40 in a buffer containing 50 mM HEPES, pH 7.4, 0.1% BSA, 10% FCS and protease inhibitors.
- Compounds which inhibit A ⁇ aggregation with an IC 50 ⁇ 100 micromolar may be effective in inhibiting the binding of A ⁇ to alpha-7 in such a manner as to have a positive therapeutic effect useful for the treatment of neurodegenerative disorders.
- synaptosomes from guinea pig hippocampus were incubated with 0.1 ⁇ M 3 H-choline and then subjected to repeated washes to remove unincorporated 3 H-choline.
- the synaptosomes were treated with 65 mM K + for 30 seconds to elicit 3H-acetylcholine release. While A ⁇ 1-40 and A ⁇ 1-42 at 100 pM both inhibited acetylcholine release from these preparations (33% inhibition for both A ⁇ 1-40 and A ⁇ 1-42 ), pretreatment of the synaptosomes with both 10 nM of Compound 9 and 100 pM of either A ⁇ 1-40 and A ⁇ 1-42 prior to K + stimulation was found to have no effect on acetylcholine release.
- alpha-7 nAChR contained SK-N-MC cell membranes were immobilized on wheat germ agglutinin coupled yittrium SPA beads and allowed to incubate with 125 I-A ⁇ 1-40 in the presence of various concentrations of compound 9.
- Compounds which inhibit the binding of A ⁇ to alpha-7 nAChRs with an IC 50 ⁇ 1 micromolar may have a positive therapeutic effect useful for the treatment of neurodegenerative disorders.
- a 2-5 ug quantity of the 11 amino acid peptide comprised of the 206-216 stretch of the ⁇ 7 nAChR (N-Ac, C(O)NH 2 ) are added to a 96-well microtiter plate in 50 mL 10 mM HEPES, pH 7.4, or any buffer 50 ul.
- 125 I- ⁇ -amyloid 1-40 2000 Ci/mmol, 50 pM was added to the wells in the presence and absence of inhibitors (1 uM to 10 uM) dissolved in 1 uL of 30% or 100% DMSO. Unbound ligands were removed and bound radioactivity was measured using a Microbeta liquid scintillation counter. Ligand binding can be inhibited by ⁇ -bugarotoxin, the peptide itself, and Compound 9.
- Biological data for representative compounds of the present invention is provided in Table 2 which follows. TABLE 2 % ⁇ 7 % ACh nAChR Release at % Inh Agg. 206-216 10 ⁇ M Cp. # (conc ⁇ M) Binding (IC 50, ⁇ M) 9 >90 (10) 94 94 (0.1) 15 50-90 (10) 85 (0.25) 16 50-90 (10) 44 (10) 7 50 (100) NT NT 8 50-90 (10) NT (0.7) 17 >90 (10) NT 63 (1) 18 50-90 (10) NT 70 (10) 19 30 (5) NT NT 20 39 (5) NT NT 21 20 (5) NT NT 22 38 (50) NT NT 23 NT 54 NT 24 NT 43 NT 25 NT 48 NT 26 ⁇ 30 (10) 64 NT 27 NT NT NT 28 50-90 (10) 34 NT 29 12 (10) NT NT 30 38 (5) NT NT 31 34 (10) NT NT 32 69 (10)
Abstract
The invention is directed to a method of treating a neurodegenerative disorder in a subject in need thereof which comprises administering to the subject an amount of a compound effective to inhibit the interaction of amyloid-beta with alpha-7 nicotinic acetylcholine receptors.
Description
- This application claims priority from U.S. provisional application Serial No. 60/087,577, filed Jun. 1, 1998, the contents of which are hereby incorporated by reference.
- The present invention provides a method for treating neurodegenerative disorders. More particularly, a method for treating neurodegenerative disorders (e.g., Alzheimer's disease) by inhibiting the interaction of amyloid beta with alpha-7 nicotinic acetylcholine receptors.
- Neurodegenerative disorders such as Alzheimer's disease (AD) and Parkinson's disease (PD) afflict humanity with great suffering and financial loss. AD is characterized by neurofibrillary tangles, neuritic plaques, and neuronal cell death. AD appears as either the familial, early onset (<60 yrs) or late-onset (>60 yrs) forms, with the latter being more prevalent. AD is the major cause of age-related dementia and cognitive impairment (Wisniewski, T.; Ghiso, J.; Frangione, B.Neurobiol. of Disease 1997, 4, 313-328). The amyloid precursor protein (APP), β-amyloid1-40 (Aβ1-40), and β-amyloid1-42 (Aβ1-42) are keenly involved in the pathology of AD. The Aβ peptides are derived from APP by proteolytic processing. Dramatic evidence implicating the Aβ peptides, particularly Aβ1-42, in AD comes from various recently identified mutations accounting for certain types of inherited AD. Such mutations in the presenilin (PS1 and PS2) genes are probably the cause of the most frequent form of familial, early-onset AD (Rogaev, E. I. Molecular Biology 1998, 32, 58). In these cases, as with APP mutations, more Aβ1-42 is observed relative to Aβ1-40. Extensive studies have shown that Aβ1-42 has a greater ability than Aβ1-40 to aggregate into the amyloid fibrils that constitute the plaques characteristic of AD (Lansbury, P. T., Jr. Accts. Chem. Res. 1996, 29, 317). Even though Aβ1-40 is generally present to a much larger degree in the cerebrospinal fluid than Aβ1-42, it is Aβ1-42 which is the major Aβ peptide found in AD plaques.
- The Aβ peptides can inhibit cholinergic neurotransmitter function independent of neurotoxicity (Auld, D. S.; Kar, S.; Quirion, R.Trends Neurosci. 1998, 21, 43). Aβ peptides bind to a number of natural substances such as apoE3, apoE4, apoJ, transthyretin, and albumin. In addition, Aβ has been reported to interact with a membrane-bound receptor for advanced glycation end products and to the class A scavenger receptor (SR) associated with the production of reactive oxygen species. Stimulation of the alpha-7 subtype of the nicotinic acetylcholine receptors (nAChRs) can protect neurons against Aβ cytotoxicity (Kihara, T. et al. Ann. Neurol. 1997, 42, 159). Also, a set of compounds that activate nAChRs, especially of the alpha-7 subtype, have been found to have in vivo activity in models of cognition enhancement (U.S. Pat. No. 5,741,802, issued Apr. 21, 1998).
- We now describe specific binding of Aβ1-40 and Aβ1-42 to the alpha-7 subtype of nAChRs. This new finding has broad ramifications for the etiology and treatment of AD. nAChRs are members of the ligand-gated ion channel family and appear to be formed from five protein subunits associating together around a central pore (Lindstrom, J. Molecular Neurobiology 1997, 15, 193). These subunits include α1-α9, β1-β4, γ, δ, and ε. The α7 subtype forms functional homomers which bind to α-bungarotoxin, a 75-amino acid peptide, with high affinity (0.65-1.7 nM Kd) and nicotine with relatively low affinity (ca. micromolar Kd) (Holladay, M. W.; Dart, M. J.; Lynch, J. K. J. Med. Chem. 1997, 40, 4169).
- Compounds which block the aggregation of Aβ peptides are potentially useful drugs for the treatment of AD. For example, rifampicin inhibits Aβ aggregation and neurotoxicity and may show an effect in vivo in diminishing plaque burden when compared with age-matched controls (Tomiyama, T. et al.J. Biol. Chem. 1996, 271, 6839). In order to block the interaction of the Aβ peptides with α7 nAChRs, compounds can be found to either bind to α7 nAChRs, to Aβ itself, or to both. Any of these mechanisms of action would be expected to provide significant protection against Aβ-mediated neurotoxicity and inhibition of cholinergic functioning mediated by nAChRs and be extremely useful for the treatment of AD. The binding of Aβ1-42 to alpha-7 nAChRs provides a seed for crystallization or deposition of Aβ into insoluble deposits, which have the potential to grow into the fibrillar amyloid deposits characteristic of AD. Therefore, blocking the interaction of Aβ1-42 with alpha-7 nAChRs should reduce the amount of insoluble aggregated Aβ that is formed, and thus prevent the neurotoxicity and pathology associated with such aggregated amyloid deposits.
- Accordingly, it is an object of the invention to provide a method for treating neurodegenerative disorders by inhibiting the binding of amyloid beta peptides to alpha-7 nicotinic acetylcholine receptors. It is a further object of the invention to provide a method for treating Alzheimer's disease and/or for slowing the progression of Alzheimer's disease by inhibiting the binding of amyloid beta peptides to alpha-7 nicotinic acetylcholine receptors. Another object of the invention is to provide a predictive method, a method for diagnosis, a method to monitor prognosis, a method to monitor the progression, and a method to monitor the therapeutic efficacy for any therapeutic intervention used in Alzheimer's disease. Still another object of the invention is to provide a method for identifying compounds which inhibit the binding of Aβ peptides with α7 nAChRs, either by binding to Aβ peptides or to α7 nAChRs.
- The present invention is directed to a method of treating a neurodegenerative disorder in a subject (preferably, a human) in need thereof which comprises administering to the subject an amount of a compound effective to inhibit the binding of an amyloid beta peptide, preferably Aβ1-42, to alpha-7 nAChRs, preferably, human alpha-7 nAChRs. Since alpha-8 and alpha-9 nAChRs are similar with respect to structure and function to alpha-7 nAChRs, it is possible that blocking the interaction of β-amyloid with alpha-8 and alpha-9 nAChRs would have therapeutic benefit as well.
- Neurodegenerative disorders included within the methods of the present invention include, but are not limited to, Alzheimer's disease, Pick's disease, diffuse Lewy body disease, progressive supranuclear palsy (Steel-Richardson syndrome), multisystem degeneration (Shy-Drager syndrome), motor neuron diseases including amyotrophic lateral sclerosis, degenerative ataxias, cortical basal degeneration, ALS-Parkinson's-Dementia complex of Guam, subacute sclerosing panencephalitis, Huntington's disease, Parkinson's disease, synucleinopathies, primary progressive aphasia, striatonigral degeneration, Machado-Joseph disease/spinocerebellar ataxia type 3 and olivopontocerebellar degenerations, Gilles De La Tourette's disease, bulbar and pseudobulbar palsy, spinal and spinobulbar muscular atrophy (Kennedy's disease), primary lateral sclerosis, familial spastic paraplegia, Werdnig-Hoffmann disease, Kugelberg-Welander disease, Tay-Sach's disease, Sandhoff disease, familial spastic disease, Wohifart-Kugelberg-Welander disease, spastic paraparesis, progressive multifocal leukoencephalopathy, and prion diseases (including Creutzfeldt-Jakob, Gerstmann-Sträussler-Scheinker disease, Kuru and fatal familial insomnia).
- Other conditions also included within the methods of the present invention include age-related dementia and other dementias and conditions with memory loss including vascular dementia, diffuse white matter disease (Binswanger's disease), dementia of endocrine or metabolic origin, dementia of head trauma and diffuse brain damage, dementia pugilistica and frontal lobe dementia. Also other neurodegenerative disorders resulting from cerebral ischemia or infaction including embolic occlusion and thrombotic occlusion as well as intracranial hemorrhage of any type (including, but not limited to, epidural, subdural, subarachnoid and intracerebral), and intracranial and intravertebral lesions (including, but not limited to, contusion, penetration, shear, compression and laceration).
- Preferably, the neurodegenerative disorder is selected from Alzheimer's disease, Parkinson's disease, Tourette's syndrome, amyotrophic lateral sclerosis, age-related memory loss, senility and age-related dementia, most preferably, the neurodegenerative disorder is Alzheimer's disease. Because, most preferably, the neurodegenerative disorder is Alzheimer's disease, also defined as an amyloidosis, other conditions within the methods of the present invention include other amyloidosis which share features including, but not limited to, hereditary cerebral angiopathy, nonneuropathic hereditary amyloid, Down's syndrome, macroglobulinemia, secondary familial Mediterranean fever, Muckle-Wells syndrome, multiple myeloma, pancreatic- and cardiac-related amyloidosis, chronic hemodialysis arthropathy, and Finnish and Iowa amyloidosis.
- In one embodiment of the invention is a method of treating and/or preventing dementia in an Alzheimer's patient (as well as a method for treating and/or preventing other clinical manifestations of Alzheimer's disease that include, but are not limited to, cognitive and language deficits, apraxias, depression, delusions and other neuropsychiatric symptoms and signs, and movement and gait abnormalities) which comprises administering to the subject a therapeutically effective amount of a compound to inhibit the binding of an amyloid beta peptide (preferably, Aβ1-42) with nAChRs, preferable alpha-7 nAChRs, most preferably, human alpha-7 nAChRs.
- In a second embodiment of the invention is a method of improving memory and/or mental status and/or of halting the progression of mental deterioration in an Alzheimer's disease patient which comprises administering to the subject a therapeutically effective amount of a compound to inhibit the binding of an amyloid beta peptide (preferably, Aβ-1-42) with nAChRs, preferably alpha-7 nAChRs, most preferably, human alpha-7 nAChRs.
- Preferably, the compound used in the methods of treating neurodegenerative disorders, treating and/or preventing Alzheimer's disease, and improving memory and/or halting the progression of mental deterioration in an Alzheimer's disease patient is not estrogen, raloxifene, droloxifene, tamoxifen, idoxifene or levomeloxifene; more preferably, the compound is not estrogen or a selective estrogen receptor modulator (SERM). A SERM is an estrogen receptor ligand that exhibits estrogen agonist activity in the cardiovascular system, CNS and bone, and estrogen antagonist activity in reproductive tissues, such as breast and uterus.
- Also included in the invention is the use of a compound which inhibits the binding of an amyloid beta peptide (preferably Aβ1-42) to an alpha-7 nAChR (preferably, a human alpha-7 nAChR) in the preparation of a medicament for the treatment of a neurodegenerative disorder in a subject (preferably, a human) in need thereof.
- Another illustration of the invention is the use of a compound which inhibits the binding of an amyloid beta peptide (preferably Aβ1-42) to alpha-7 nAChRs (preferably, human alpha-7 nAChRs) in the preparation of a medicament for: a) improving memory, b) halting the progression of the mental deterioration seen in Alzheimer's disease patients, c) treating dementia, d) preventing dementia in an Alzheimer's patient, and e) treating and/or preventing other clinical manifestations of Alzheimer's disease that include, but are not limited to, cognitive and language deficits, apraxias, depression, delusions and other neuropsychiatric symptoms and signs, and movement and gait abnormalities in an Alzheimer's patient.
-
- wherein
- R1 is hydrogen or C1-C4 alkyl;
- R2 is selected from hydrogen, C1-C6 alkyl, aryl or C7-C10 aralkyl;
- R3 is selected from hydrogen, C1-C6 alkyl, C3-C10 alkenyl, C3-C8 cycloalkylC1-C6 alkyl, C1-C6 alkoxycarbonylC1-C6 alkyl, C1-C6 alkylthio, heteroarylC1-C4 alkyl, unsubstituted or substituted aryl or unsubstituted or substituted C7-C10 aralkyl wherein the substituent on the aryl or aralkyl are one or more substituents independently selected from the group consisting of halogen, hydroxy, C1-C6 alkyl and unsubstituted or substituted C1-C6 alkoxy wherein the substituents on the alkoxy are one or more substituents independently selected from amino, C1-C6 alkylamino, C1-C6 dialkylamino, pyrrolidinyl, piperidinyl, azepinyl or morpholinyl; or R2 and R3, together with the nitrogen to which they are attached, form a five or six-membered heterocyclic ring selected from pyrrolidinyl, piperidinyl, morpholinyl, thiomorpholinyl or piperazinyl;
- R4 is C1-C6 alkyl, aryl, or C7-C10 aralkyl; and
- R5 and R6 are each independently selected from hydrogen, C1-C6 alkyl, C3-C10 alkenyl, C1-C8 alkylcarbonyl, or diphenylphosphinyl; and pharmaceutically acceptable salts and prodrugs thereof.
- In preferred compounds of formula I,
- R1 is hydrogen;
- R2 is selected from hydrogen or C1-C4 alkyl;
- R3 is selected from C1-C4 alkyl, C3-C10 alkenyl, C5-C6 cycloalkylC1-C46 alkyl, C1-C6 alkoxycarbonylC1-C4 alkyl, C1-C6 alkylthio, heteroarylC1-C4 alkyl, or unsubstituted or substituted C7-C10 aralkyl wherein the substituent on the aralkyl are one or two substituents independently selected from the group consisting of halogen, hydroxy, C1-C4 alkyl and unsubstituted or substituted C1-C4 alkoxy wherein the substituents on the alkoxy are one or two substituents independently selected from amino, C1-C4 alkylamino, C1-C4 dialkylamino, pyrrolidinyl, or piperidinyl; or
- R2 and R3, together with the nitrogen to which they are attached, form a morpholinyl ring;
- R4 is C1-C4 alkyl; and
- R5 and R6 are each independently selected from hydrogen, C1-C4 alkyl, C3-C6 alkenyl, C1-C6 alkylcarbonyl, or diphenylphosphinyl.
-
- wherein
- R1 is hydrogen or C1-C4 alkyl;
- R2 and R3 are each independently selected from hydrogen, C1-C6 alkyl, aryl or C7-C10 aralkyl; and
- R4 is C1-C6 alkyl, aryl, or C7-C10 aralkyl;
- and pharmaceutically acceptable salts thereof.
- Compounds of formula I are novel compounds which block the interaction of beta-amyloid with alpha-7 nAChRs. More specifically, the compounds of formula I inhibit the binding of Aβ1-42with human alpha-7 nAChRs by binding to Aβ1-42. The orientation between the nitrogen atom and R4 on the appropriate ring can be either cis or trans. Preferably, the compound is 5,8-dihydroxy-trans-2-di(N-propylamino)-3-methyl-1,2,3,4-tetrahydronaphthalene, and pharmaceutically acceptable salts thereof.
- Other compounds useful in the methods of the present invention inhibit the binding of Aβ1-42 with human alpha-7 nAChRs by binding to human alpha-7 nAChRs directly. An example of such a compound which binds to human alpha-7 nAChRs is α-bungarotoxin.
- The present invention provides methods of treating neurodegenerative disorders by inhibiting the binding of amyloid beta peptides to alpha-7 nAChRs. Neurodegenerative disorders included within the methods of the present invention include, but are not limited to, Alzheimer's disease, Pick's disease, diffuse Lewy body disease, progressive supranuclear palsy (Steel-Richardson syndrome), multisystem degeneration (Shy-Drager syndrome), motor neuron diseases including amyotrophic lateral sclerosis, degenerative ataxias, cortical basal degeneration, ALS-Parkinson's-Dementia complex of Guam, subacute sclerosing panencephalitis, Huntington's disease, Parkinson's disease, synucleinopathies, primary progressive aphasia, striatonigral degeneration, Machado-Joseph disease/spinocerebellar ataxia type 3 and olivopontocerebellar degenerations, Gilles De La Tourette's disease, bulbar and pseudobulbar palsy, spinal and spinobulbar muscular atrophy (Kennedy's disease), primary lateral sclerosis, familial spastic paraplegia, Werdnig-Hoffmann disease, Kugelberg-Welander disease, Tay-Sach's disease, Sandhoff disease, familial spastic disease, Wohlfart-Kugelberg-Welander disease, spastic paraparesis, progressive multifocal leukoencephalopathy, and prion diseases (including Creutzfeldt-Jakob, Gerstmann-Sträussler-Scheinker disease, Kuru and fatal familial insomnia).
- Other conditions also included within the methods of the present invention include age-related dementia and other dementias and conditions with memory loss including vascular dementia, diffuse white matter disease (Binswanger's disease), dementia of endocrine or metabolic origin, dementia of head trauma and diffuse brain damage, dementia pugilistica and frontal lobe dementia. Also other neurodegenerative disorders resulting from cerebral ischemia or infaction including embolic occlusion and thrombotic occlusion as well as intracranial hemorrhage of any type (including, but not limited to, epidural, subdural, subarachnoid and intracerebral), and intracranial and intravertebral lesions (including, but not limited to, contusion, penetration, shear, compression and laceration).
- Preferably, the neurodegenerative disorder is selected from Alzheimer's disease, Parkinson's disease, Tourette's syndrome, amyotrophic lateral sclerosis, age-related memory loss, senility and age-related dementia, most preferably, the neurodegenerative disorder is Alzheimer's disease. Because, most preferably, the neurodegenerative disorder is Alzheimer's disease, also defined as an amyloidosis, other conditions within the methods of the present invention include other amyloidosis which share features including, but not limited to, hereditary cerebral angiopathy, nonneuropathic hereditary amyloid, Down's syndrome, macroglobulinemia, secondary familial Mediterranean fever, Muckle-Wells syndrome, multiple myeloma, pancreatic- and cardiac-related amyloidosis, chronic hemodialysis arthropathy, and Finnish and Iowa amyloidosis.
- The terms “amyloid beta”, “amyloid beta peptide” or “beta-amyloid” as used herein, refer to amyloid beta peptides and include the Aβ1-40, Aβ1-42 and Aβ1-43 peptides and their fragments. Examples of fragments of amyloid beta peptides that have been shown to have biological activity and are useful in the methods of the present invention include, but not limited to, fragment 1-28, and fragment 25-35 (e.g., Yatin S M, Aksenov M, Butterfield D A. Neurochem Res 1999 Mar;24(3):427-35; Hirakura Y, Satoh Y, Hirashima N, Suzuki T, Kagan B L, Kirino Y. Biochem Mol Biol Int 1998 Nov; 46(4):787-94; Mazziotti M, Perlmutter D H. Biochem J 1998 Jun 1;332 (Pt 2):517-24; Perovic S, Bohm M, Meesters E, Meinhardt A, Pergande G, Muller W E. Mech Ageing Dev 1998 Mar 16;101 (1-2):1-19; Muller W E, Eckert G P, Scheuer K, Cairns N J, Maras A, Gattaz W F. Amyloid 1998 Mar;5(1):10-5; Butterfield D A, Martin L, Carney J M, Hensley K. Life Sci 1996;58(3):217-28; Forloni G, Lucca E, Angeretti N, Della Torre P, Salmona M. J Neurochem 1997 Nov;69(5):2048-54; Heese K, Hock C, Otten U. J Neurochem 1998 Feb;70(2):699-707; Blanchard B J, Konopka G, Russell M, Ingram V M. Brain Res 1997 Nov 21 ;776(1-2):40-50; Wu A, Derrico C A, Hatem L, Colvin R A. Neuroscience 1997 Oct;80(3):675-84; Muller W E, Romero F J, Perovic S, Pergande G, Pialoglou P. J Neurochem 1997 Jun;68(6):2371-7; Suh Y H. J Neurochem 1997 May;68(5):1781-91; Parpura-Gill A, Beitz D, Uemura E. Brain Res 1997 Apr 18;754(1-2):65-71; Fletcher T G, Keire D A. Protein Sci 1997 Mar;6(3):666-75; Scorziello A, Meucci O, Calvani M, Schettini G. Neurochem Res 1997 Mar;22(3):257-65); Miguel-Hidalgo J J, Vecino B, Fernandez-Novoa L, Alvarez A, Cacabelos R. Eur Neuropsychopharmacol 1998 Aug;8(3):203-8; Maneiro E, Lombardi V R, Lagares R, Cacabelos R. Methods Find Exp Clin Pharmacol 1997 Jan-Feb; 19(1):5-12).
- The term “subject” as used herein, refers to an animal, preferably a mammal, most preferably a human, who has been the object of treatment, observation or experiment.
- The term “therapeutically effective amount” as used herein, means that amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue system, animal or human that is being sought by a researcher, veterinarian, medical doctor or other clinician, which includes alleviation of the symptoms of the disease or disorder being treated.
- The term “alkyl” shall mean straight or branched chain alkanes of one to ten carbon atoms, or any number within this range. For example, alkyl radicals include, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, t-butyl, n-pentyl, 3-(2-methyl)butyl, 2-pentyl, 2-methylbutyl, neopentyl, n-hexyl, 2-hexyl and 2-methylpentyl. Alkoxy radicals are oxygen ethers formed from the previously described straight or branched chain alkyl groups. Cycloalkyl groups contain 3 to 8 ring carbons and preferably 5 to 7 carbons. Similarly, alkenyl and alkynyl groups include straight and branched chain alkenes and alkynes having 2 to 10 carbon atoms, or any number within this range.
- The term “aryl” indicates aromatic groups such as phenyl and naphthyl.
- The term “C7-C10 aralkyl” means an alkyl group substituted with an aryl group wherein the total number of carbon atoms is between 7 and 10 (e.g., benzyl, phenylethyl, phenylpropyl).
- The term “heteroaryl” as used herein represents an unsubstituted or substituted stable five or six membered monocyclic aromatic ring system or an unsubstituted or substituted nine or ten membered benzo-fused heteroaromatic ring system or bicyclic heteroaromatic ring system which consists of carbon atoms and from one to four heteroatoms selected from N, O or S, and wherein the nitrogen or sulfur heteroatoms may optionally be oxidized, and the nitrogen heteroatom may optionally be quaternized. The heteroaryl group may be attached at any heteroatom or carbon atom that results in the creation of a stable structure. Examples of heteroaryl groups include, but are not limited to pyridyl, pyridazinyl, thienyl, furanyl, imidazolyl, isoxazolyl, oxazolyl, pyrazolyl, pyrrolyl, thiazolyl, thiadiazolyl, triazolyl, benzimidazolyl, benzofuranyl, benzothienyl, benzisoxazolyl, benzoxazolyl, benzopyrazolyl, indolyl, benzothiazolyl, benzothiadiazolyl, benzotriazolyl adeninyl or quinolinyl. Prefered heteroaryl groups include pyridyl, pyrrolyl, pyrazinyl, thiadiazolyl, pyrazolyl, thienyl, triazolyl and quinolinyl.
- The term “N(CH2)5” means a piperidinyl group.
- The term “cC6H11” refers to a cyclohexyl group.
- When a particular group is “substituted” (e.g., aryl, aralkyl), that group may have one or more substituents, preferably from one to five substituents, more preferably from one to three substituents, most preferably from one to two substituents, independently selected from the list of substituents.
-
- Compounds which are useful in the methods of the present invention for inhibiting the interaction of Aβ1-40 and Aβ1-42 to the alpha-7 subtype of nAChRs for either the purpose of direct therapeutic intervention or in order to screen for compounds which act via this mechanism include compounds of formula I, especially 5,8-dihydroxy-trans-2-di(N-propylamino)-3-methyl-1,2,3,4-tetrahydronaphthalene (Compound 9), (−)-nicotine, (rac)-epibatidine, α-bungarotoxin, and pharmaceutically acceptable salts thereof.
- Certain peptide stretches of the human alpha-7 nAChR bind to amyloid beta and can be used in place of the alpha-7 nAChR together with amyloid beta for the purpose of screening libraries to find compounds which block the interaction of amyloid beta and the human alpha-7 nAChR. Included among these peptide stretches of the human alpha-7 nAChR are alpha-7 nAChR193-224 and smaller peptides derived thereof as listed in the Table.
TABLE Amelioration of the Aβ1-42 Meditated Inhibition of ACh Release in Rat Cortical Syn- Compound aptosomes (%) human alpha-7 81% at 10 μM nAChR193-224 79% at 1 μM Ac- NGEWDLVGIPGKRSERFYECCKEPYPDVTFTV- NH2 human alpha-7 79% at 10 μM nAChR200-214 71% at 1 μM Ac-GIPGKRSERFYECCK-NH2 human alpha-7 81% at 10 μM nAChR206-216 77% at 1 μM Ac-SERFYECCKEP-NH2 human alpha-7 84% at 10 μM nAChR206-216 82% at 1 μM oxidized (cyclic) CC: Ac-SERFYECCKEP-NH2 human alpha-7 22% at 10 μM nAChR206-216 10% at 1 μM SERFYECCKEP human alpha-7 72% at 10 μM nAChR210-213 59% at 1 μM Ac-YECC-NH2 - The standard one-letter code for the amino acids has been employed for the compounds. This code is listed in Lehninger, A. I. “Biochemistry” Second Edition, Worth Publishers, Inc., New York, 1976, p 73-75.
- For use in medicine, the salts of the compounds of this invention refer to non-toxic “pharmaceutically acceptable salts.” Other salts may, however, be useful in the preparation of compounds according to this invention or of their pharmaceutically acceptable salts. Suitable pharmaceutically acceptable salts of the compounds of this invention include acid addition salts which may, for example, be formed by mixing a solution of the compound with a solution of a pharmaceutically acceptable acid such as hydrochloric acid, sulfuric acid, fumaric acid, maleic acid, succinic acid, acetic acid, benzoic acid, citric acid, tartaric acid, carbonic acid or phosphoric acid. Furthermore, where the compounds of the invention carry an acidic moiety, suitable pharmaceutically acceptable salts thereof may include alkali metal salts, e.g., sodium or potassium salts; alkaline earth metal salts, e.g., calcium or magnesium salts; and salts formed with suitable organic ligands, e.g., quaternary ammonium salts.
- The present invention includes within its scope prodrugs of the compounds of this invention. A prodrug is inactive as administered, but becomes activated in vivo. The prodrug is converted to the parent drug chemically or by specific enzyme(s). Higuchi, T.; Stella, V., Eds. “Pro-Drugs as Novel Drug Delivery Systems”; American Chemical Society: Washington, D.C., 1976. In general, such prodrugs will be functional derivatives of the compounds which are readily convertible in vivo into the required compound. Thus, in the methods of treatment of the present invention, the term “administering” shall encompass the treatment of the various disorders described with the compound specifically disclosed or with a compound which may not be specifically disclosed, but which converts to the specified compound in vivo after administration to the patient. Conventional procedures for the selection and preparation of suitable prodrug derivatives are described, for example, in “Design of Prodrugs”, ed. H. Bundgaard, Elsevier, 1985.
- Where the compounds according to this invention have at least one chiral center, they may accordingly exist as enantiomers. Where the compounds possess two or more chiral centers, they may additionally exist as diastereomers. It is to be understood that all such isomers and mixtures thereof are encompassed within the scope of the present invention. Furthermore, some of the crystalline forms for the compounds may exist as polymorphs and as such are intended to be included in the present invention. In addition, some of the compounds may form solvates with water (i.e., hydrates) or common organic solvents, and such solvates are also intended to be encompassed within the scope of this invention.
-
-
- α-Bungarotoxin is a 74 amino acid peptide which is commercially available from Research Biochemicals Inc. α-Bungarotoxin and its amino acid sequence are described in Lee, C. Y.Annu. Rev. Pharmacol. 1972, 12, 265-281.
-
-
- The present invention therefore provides a method of treating a neurodegenerative disorder, which comprises administering any of the compounds as defined herein in a quantity effective to treat the neurodegenerative disorder. Preferably, the compound is not estrogen, raloxifene, droloxifene, tamoxifen, idoxifene or levomeloxifene; more preferably, the compound is not estrogen or a selective estrogen receptor modulator (SERM). The compound may be administered to a patient afflicted with a neurodegenerative disorder by any conventional route of administration, including, but not limited to, intravenous, oral, subcutaneous, intramuscular, intradermal, buccal, intracerebral and other parenteral routes. The quantity of the compound which is effective for treating a neurodegenerative disorder is between 0.01 mg per kg and 10 mg per kg of subject body weight.
- The method of treating neurodegenerative disorders described in the present invention may also be carried out using a pharmaceutical composition comprising any of the compounds as defined herein and a pharmaceutically acceptable carrier. The pharmaceutical composition may contain between about 0.5 mg and 200 mg of the compound, and may be constituted into any form suitable for the mode of administration selected. Carriers include necessary and inert pharmaceutical excipients, including, but not limited to, binders, suspending agents, lubricants, flavorants, sweeteners, preservatives, dyes, and coatings. Compositions suitable for oral administration include solid forms, such as pills, capsules, granules, tablets, caplets, and powders, and liquid forms, such as solutions, syrups, elixers, and suspensions. Forms useful for intracerebral and other parenteral routes of administration include sterile solutions, emulsions and suspensions.
- Optimal dosages to be administered may be readily determined by those skilled in the art, and will vary with the particular compound used, the mode of administration, the strength of the preparation, the mode of administration, and the advancement of the disease condition. In addition, factors associated with the particular patient being treated, including patient age, body weight, diet, physical activity and time of administration, and associated co-morbidities and clinical conditions will result in the need to adjust dosages.
- The present invention also provides diagnostic tools useful for diagnosing Alzheimer's disease. Alzheimer's disease (AD) exhibits neuropathological abnormalities in the olfactory system located in the nasal cavity. These include the presence of dystrophic neurites that exhibit immunoreactivity for tau, neurofilaments, apolipoprotein E and other proteins, abnormal tau protein, increase in superoxide dismutase, and beta-amyloid deposition in the primary sensory (olfactory receptor) cells and nerve fibres of the nasal mucosa tissue (Arnold et al., Ann N Y Acad Sci 1998 Nov 30;855:762-75; Hock et al., Eur Neurol 1998 Jul;40(1):31-6; Johnson et al., Neurobiol Aging 1994 Nov-Dec; 15(6):675-80; Kulkarni-Narla et al., Exp Neurol 1996 Aug;140(2):115-25; Lee et al., Exp Neurol 1993 May;121(1):93-105; Tabaton et al., Neurology 1991 Mar;41 (3):391-4; Talamo et al., Ann N Y Acad Sci 1991;640:1-7; Yamagishi et al., Ann Otol Rhinol Laryngol 1998 May;107(5 Pt 1):421-6; Yamagishi et al., Nippon Jibiinkoka Gakkai Kaiho 1994 Jan;97(1):51-60). These observations recapitulate the neuropathological profile and neurodegenerative abnormalities (e.g., cytoskeletal changes, protein immunoreactivity and beta-amyloid deposition) observed in central nervous system neurons from AD patients. Routine access to these sensory neurons and fibers can be done with nasal biopsy in AD patients (e.g., Feron et al., Arch Otolaryngol Head Neck Surg 1998 Aug;124(8):861-6).
- Olfactory neuroblasts (olfactory neurons obtained by biopsy and placed in primary cell culture) from AD patients produce carboxy terminal amyloid precursor protein (APP) fragments that contain beta-amyloid (A-beta)(Crino et al., Ann Otol Rhinol Laryngol 1995 Aug;104(8):655-61). Crino et al. showed labeling of A-beta in the basal third of the olfactory neuroepithelium and in axons projecting through the lamina propria of AD patients. Thioflavin-S staining that detects amyloid deposition was also observed in the basal third of the olfactory neuroepithelium from AD patients. Alpha 7 nicotinic acetylcholine receptors are present in olfactory neurons probably including olfactory receptor cells in the nasal cavity (Alkondon et al., Neurosci Lett 1994 Aug 1;176(2):152-6; Alkondon et al., Eur J Neurosci 1997 Dec;9(12):2734-42; Bouvet et al., Neurosci Res 1988 Feb;5(3):214-23; Edwards et al., Experientia 1987 Aug 15;43(8):868-73; Edwards et al., Experientia 1988 Mar 15;44(3):208-11; Seguela et al., J Neurosci 1993 Feb;13(2):596-604).
- Beta-amyloid peptide increases cytosolic-free Ca2+ in AD lymphoblasts (Ibarreta et al., Alzheimer Dis Assoc Disord 1997 Dec;11(4):220-7), and elevates mitogen-induced Ca2+ responses in freshly prepared human lymphocytes (Eckert et al., Life Sci 1994;55(25-26):2019-29). Amyloid precursor protein (APP) can be induced on the cell surface of human lymphocytes upon stimulation (Bullido et al., Biochim Biophys Acta 1996 Aug 21;1313(1):54-62) and increased APP-770 isoform occurs in lymphocytes from AD patients (Ebstein et al., Brain Res Mol Brain Res 1996 Jan;35(1-2):260-8). Lymphoblastoid cells from patients with early-onset and late-onset familial AD show increased expression of beta-APP mRNA and protein (Matsumoto et al., Eur J Biochem 1993 Oct 1;217(1):21-7). Lymphocytes from AD patients also exhibit an increased mRNA level for alpha 7 nicotinic receptor (Hellstrom-Lindahl et al., Brain Res Mol Brain Res 1999 Mar 20;66(1-2):94-103)
- Based on the information described above, we propose that the analysis of the alpha 7 nicotinic acetylcholine receptor—beta amyloid peptides interaction in circulating blood cells and olfactory neuroepithelial neurons/neuronal processes or olfactory neuroblasts obtained from AD patients could be used as AD diagnostic tools, markers of AD progression and prognosis, and markers of therapeutic efficacy for any intervention or treatment targeting AD.
- Thus, the present invention provides methods for diagnosing Alzheimer's disease, monitoring the progression and prognosis of Alzheimer's disease and/or monitoring the therapeutic efficacy of any intervention or treatment of Alzheimer's disease comprising:
- (a) obtaining a test sample from a subject wherein the test sample comprises circulating blood cells and/or olfactory neuroepithelial neuronal cell bodies or their neuronal processes (i.e., dendrites and axon of a nueron); and
- (b) analyzing the test sample for interaction of an amyloid beta peptide (including, but not limited to, Aβ1-40, Aβ1-42 and Aβ1-43 peptides and their fragments) with alpha-7 nicotinic acetylcholine receptors.
- The compounds of formula I, such as 5,8-Dihydroxy-trans-2-di(N-propylamino)-3-methyl-1,2,3,4-tetrahydronaphthalene (Compound 9), are made according to the procedures described in the Schemes and Examples which follow.
- Abbreviations used in the instant specification, particularly the Schemes and Examples, are as follows:
- Ac=acetyl
- Ach=acetylcholine
- AcOH=acetic acid
- BSA=bovine serum albumin
- DMF=N,N-dimethyl formamide
- DMSO=dimethyl sulfoxide
- Et3N=triethyl amine
- EtOAc=ethyl acetate
- FCS=fetal calf serum
- i-Pr=isopropyl
- Me=methyl
- Mel=methyl iodide
- nAChR=nicotinic acetylcholine receptor
- Ph=phenyl
- PCC=pyridinium chlorochromate
- TEA=triethyl amine
- THF=tetrahydrofuran
-
- Compounds of the invention can be prepared as shown in Scheme 1. First a Diels-Alder reaction is performed on benzophenone (1) with a suitable diene such as isoprene to give a dione such as (2). Then, base-catalyzed isomerization of (2) affords a 1,4-dihydroxyphenyl compound (3), which is converted to dimethyl ether (4). Hydroboration followed by oxidation give alcohol (5), which is then oxidized to give ketone (6). Reductive amination with an amine such as propyl amine is then carried out using a suitable hydride reducing agent such as sodium cyanoborohydride, to give, for example, compound 7. This material can then be subjected to a reductive amination reaction such as with propionaldehyde as shown to yield (8). Compound (8) is then treated with HBr in acetic acid to cleave the methyl ethers and form dihydroxy compound (9). Alternatively, BBr3 may be used to cleave the methyl ethers and form dihydroxy compound (9). Moreover, a deficiency of BBr3 may be used to provide compounds in which only one of the methyl ethers has been removed to afford compounds with one hydroxy and one methoxy group.
- A further means of preparing compounds of the present invention is illustrated in Scheme 2. A suitable propargyl alcohol, such as 3-hydroxy-3-methyl-1-butyne (10, R4=Me) is dehydrated to give an enyne such as compound 11. This material is then subjected to an aminomercuration reaction to afford a 2-amino-1,4-butadiene such as compound (12). Diels-Alder reaction of compound (12) with benzophenone (1) gives (13) which can be isomerized as in Scheme 1 with base to give the 1,5-dihyroxy compound (14). Reduction of the double bond of (14) catalytically with hydrogen and palladium on carbon, such as 10% palladium on carbon, yields compounds of the invention such as (15).
- Compounds of type 9 can be treated with a base such as triethylamine in a suitable solvent such as dioxane or methylene chloride along with electrophiles such as acid halides, phosphinyl halides, or alkyl halides to give the products of substitution on one or both of the phenolic hydroxyls. Such compounds can be active by themselves, or serve as prodrugs for compound 9.
- The following Examples are set forth to aid in the understanding of the invention, and are not intended and should not be construed to limit in any way the invention set forth in the claims which follow thereafter.
- a. 5,8-Dihydroxy-2-methyl-1,4-dihydronaphthalene (3)
- To a solution of p-benzoquinone (10.00 g, 92.5 mmol) in 1M solution of lithium perchlorate, in nitromethane (300 mL) was added isoprene (9.24 mL, 92.3 mmol) at room temperature. The resultant reaction mixture was stirred at room temperature under N2 for 4 hours. The reaction mixture was partitioned between EtOAc (500 mL) and water (200 mL). The organic layer was washed with brine, dried over sodium sulfate and concentrated to give 2 as brown solid. The reaction was repeated on 15 g of benzoquinone to afford additional 2. These two runs were combined and carried on without further purification. To a solution of 2 (35.00 g, 199 mmol) in methylene chloride (400 mL) was added triethylamine (40 mL). The reaction mixture was stirred at room temperature for 1 hr. The product was precipitated out of solution by the addition of hexane (300 mL). The solid was collected by filtration and dried in a dessicator under high vaccuum overnight to provide 3 as a light brown solid.
-
- b. 5,8-Dimethoxy-2-methyl-1,4-dihydronaphthalene (4)
- To a cold (−78° C.) solution of hydroquinone 3 (17.00 g, 96.6 mmol) in DMF under N2 was added unwashed 60% sodium hydride in mineral oil (8.90 g, 222.5 mmol). The resultant reaction mixture was warmed to room temperature over a 30 min period and subsequently treated with methyl iodide (14.3 mL, 230 mmol). After stirring the reaction mixture for 1 hr at room temperature the reaction mixture was diluted with ethyl acetate (1.5 L) and washed with brine (3×500 ml). The organic solution was dried over sodium sulfate, filtered, concentrated, and the residue purified on silica gel (elution with 20% ethyl acetate\hexane) to afford 4 as a light yellow oil which solidified upon standing.
-
- c. 5,8-Dimethoxy-trans-2-hydroxy-3-methyl-1,2,3,4-tetrahydronaphthalene (5)
- A solution of 4 (5.00 g, 24.5 mmol) in tetrahydrofuran (100 ml) was cooled to 0° C. and treated with 1 M borane-tetrahydrofuran complex (24.5 mL, 24.5 mmol) and the resulting solution was stirred at room temperature for 4 h. Then, 12 mL of 3 N NaOH solution was added slowly to the stirring reaction solution followed by the addition of 6 mL of 30% aqueous hydrogen peroxide. After stirring for 30 min, the resultant mixture was diluted with 500 mL of ethyl acetate and washed by brine (2×100 mL). The organic layer was dried over sodium sulfate, filtered and concentrated, and the residue was purified on silica gel (30% ethyl acetate\hexane) to give 5 as a white solid.
-
- d. 5,8-Dimethoxy-3-methyl-2-tetralone (6)
- A solution of alcohol 5 (10 g, 45 mmol) and dichloromethane (200 mL) at −30° C. was treated dropwise with oxalyl chloride (4.92 g, 24 mL, 0.275 mol). The reaction was stirred at −30° C. for 30 min, cooled to −60° C., and DMSO (6.4 mL) was added slowly over 15 min. The reaction was stirred for one hour, cooled to −78° C. for 30 min, and then treated dropwise with triethylamine (40 mL). The reaction was warmed to room temperature and stirred for 1 hr, followed by the addition of water and dichloromethane with thorough mixing. The organic layer was separated, dried with MgSO4, filtered and the solvent was evaporated to an oil. Purification of this material using flash chromatography (flash silica, 70/30: hexane/EtOAc) afforded 6 as a white crystalline solid.
-
- e. 5,8-Dimethoxy-2-N-propylamino-3-methyl-1,2,3,4-tetrahydronaphthalene (7)
- To a solution of 6 (0.15 g, 0.68 mmol) in acetonitrile (10 mL) was added sodium cyanoborohydride (0.085 g, 1.30 mmol), 0.05 ml of acetic acid and N-propylamine (0.08 mL, 1.3 mmol). The resulting solution was stirred at room temperature overnight and poured into 10 mL of 1 N NaOH solution. The mixture was extracted with EtOAc, dried over sodium sulfate, concentrated, and the residue purified by preparative TLC (elution with 30% ethyl acetate in hexane) to give amine 7 as a colorless oil.
-
- f. 5,8-Dimethoxy-trans-2-di(N-propylamino)-3-methyl-1,2,3,4-tetrahydronaphthalene (8)
- To a solution of 7 (0.11 g 0.42 mmol) in acetonitrile (10 ml) was added sodium cyanoborohydride (0.05 gm, 0.6 mmol), 0.03 mL of acetic acid and propionaldehyde (0.045 mL, 0.60 mmol). The resulting solution was stirred at room temperature overnight and poured into 10 mL of 1N NaOH solution. The mixture was extracted with EtOAc, dried over sodium sulfate, concentrated, and the residue was purified by preparative TLC (elution with 30% ethyl acetate in hexane) to give amine 8 as a light yellow solid.
-
- In a similar manner was prepared compounds 19, 21, 25, 27, 29, 35, 37, 39, 41, 52, and 54.
- In order to separate the enantiomers of 8, 2.859 g of 8 was passed through a CHIRALPAK® AD™ chiral cellulose-based high pressure liquid chromatography column (8 cm×30 cm) at 25° C. using hexane/isopropyl alcohol (99/1) as the eluant to give two fractions as oils. Fraction 1 (18) had a 98.6% enantiomeric excess (e.e.) and fraction 2 (17) had a 97.9% e.e. Fraction 1 (0.306 g, 1.0 mmol) and fumaric acid (0.141 g, 1.2 mmol) were dissolved in ethanol (2 mL) with heating. The ethanol was evaporated and the residue triturated with diethyl ether affording the fumarate salt of 18 as a white solid. Similarly obtained from Fraction 2 (0.301 g, 1.0 mmol) and fumaric acid (0.141 g, 1.2 mmol) was the fumarate sale of 17.
- g. 5,8-Dihydroxy-trans-2-di(N-propylamino)-3-methyl-1,2,3,4-tetrahydronaphthalene (9)
- A mixture of 8 (1.4 g, 4.6 mmol) and 3.5 mL of 48% aqueous HBr in acetic acid (3.5 mL) was stirred at 100° C. under N2 overnight. The reaction mixture was then cooled to 0° C. and extracted with diethyl ether (20 mL). The organic solution was neutralized with aqueous NaHCO3 and separated. The aqueous layer was extracted with ether (20 mL) and the combined ether solutions were dried over Na2SO4, filtered, and concentrated to give 9.
-
- In a similar manner 17 and 18 were converted to 15 and 16 respectively. Additionally, demethylation of the appropriate dimethyl ethers by the procedure described here led to the preparation of compounds 20, 22, 26, 28, 30, 32, 34, 36, 40, 42, 53, and 55. In the course of the demethylation of 37, the butyl ether was also removed to obtain 38.
- a. 5,8-Dimethoxy-cis-2-(1-morpholinyl)-3-methyl-1,2,3,4-tetrahydronaphthalene (23).
- Ketone 6 (0.299 g, 1.36 mmol) was dissolved in toluene (1 mL) followed by the addition of morpholine (0.130 g, 0.13 mL, 1.5 mmol) and Ti(i-PrO)4 (0.611 g, 0.64 mL, 2.15 mmol). The reaction mixture was stirred for 15 hrs at room temperature. Methanol (2 mL) was added followed by portionwise addition of NaBH4 (0.15 g, 3.9 mmol) over 1 hr. Dichloromethane and 1N NaOH were added with thorough mixing and the organic layer was separated, dried with MgSO4, filtered and evaporated to an oil. Purification of this material using flash chromatography (flash silica, 75/25:hexane/EtOAc) afforded product 23.
-
- b. 5,8-Dihydroxy-cis-2-(1-morpholinyl)-3-methyl-1,2,3,4-tetrahydronaphthalene (24).
- A solution of 23 (20 mg, 0.066 mmol) and dichloromethane (2 mL) at −78° C. was treated with a 1 M solution of BBr3 in dichloromethane (1 mL, 1 mmol.) and stirred for 1 hr at −78° C. After warming to room temperature, methanol (5 mL) was added and the solvents were evaporated. Methanol addition to the residue followed by evaporation was done twice. The residue was dissolved in acetonitrile (25 mL) and treated with triethylamine (2 mL). After stirring for 2 hrs, water and ethyl acetate were added with thorough mixing. The organic layer was separated, dried with MgSO4, filtered, and solvent evaporated to yield 24 as an oil.
-
- Ketone 6 (1 g, 4.5 mmol) was dissolved in acetonitrile (75 mL) followed by the addition of acetic acid (0.54 mL, 9 mmol, 2 eq.) and propargylamine (0.6 mL, 9 mmol, 2 eq.). The reaction mixture was stirred at room temperature for 1 hr. Sodium cyanoborohydride (0.6 g, 9 mmol, 2 eq.) was added portionwise (3×) over 1.5 hrs (every 30 min), and the reaction mixture was stirred overnight at room temperature. Ethyl acetate and 1 N NaOH were added with thorough mixing and the organic layer was separated, dried with MgSO4, filtered and evaporated to an oil. The product was purified with flash chromatography (50:50/ethyl acetate:hexane) to yield an oil of 5,8-dimethoxy-cis and trans-2-N-(propargyl)amino-3-methyl-1,2,3,4-tetrahydronaphthalene (1.2 g, 100%). This material was dissolved in acetonitrile along with propionaldehyde (0.65 g, 9 mmol, 2 eq.) and acetic acid (0.5 mL, 9 mmol) and stirring for 1 hr at room temperature. One hour later, sodium cyanoborohydride (0.6 g, 9 mmol, 2 eq.) was added portionwise (3×) over 1.5 hours (every 30 mins). The reaction was stirred overnight at room temperature. Ethyl acetate and 1 N NaOH were added to the reaction with thorough mixing and the organic layer was separated, dried with MgSO4, filtered and evaporated to a mixture of products 31 and 33. Purification of this material using flash chromatography (flash silica, 80:20/hexane:ether) afforded product 31 and 33. Compound 1H NMR (300 MHz, CDCl3) δ 6.6 (s, 2 H), 3.8 (s, 6 H), 3,4 (q, 2 H), 3.0 (dd, 2 H), 2.6 (m, 4 H), 2.2 (m, 2 H), 1.85 (m, 1 H), 1.5 (m, 2 H), 1.1 (d, 3 H), 0.9 (t, 3 H).
- Compound 33:1H NMR (300 MHz, CDCl3) δ 6.6 (s, 2 H), 3.78 (s, 3 H), 3.75 (s, 3 H), 3.6 (q, 2 H), 3.05 (dd, 1 H), 2.75 (m, 2 H), 2.61 (m, 3 H), 2.3 (m, 2 H), 2.1 (s,1 H), 1.55 (m, 2 H), 0.9 (t, 3 H), 0.8 (d, 3 H).
- Diol 9 (0.3 g, 1.2 mmol) was dissolved in acetone (40 mL) followed by the addition of potassium carbonate (0.19 g) and 1-bromo-3-methyl-2-butene (0.1 mL, 0.87 mmol). The reaction mixture was stirred for 48 hrs at room temperature. Dichloromethane and water were added with thorough mixing and the organic layer was separated, dried with MgSO4, filtered and the solvent was evaporated to yield an oil. Purification of this material using flash chromatography (flash silica, 70:30/hexane:ether) afforded products 43 and 44. The regiochemical structural assignment between the two of them is uncertain. Compound 43: 1H NMR (300 MHz, CDCl3) δ 6.5 (s, 2 H), 5.5 (t, 1 H), 4.4 (m, 2 H), 3.0 (m, 2 H), 2.4 (m, 8 H), 1.8 (m, 1 H), 1.72 (s, 3 H), 1.65 (s, 3 H), 1.4 (m, 4 H), 1.1 (dd, 3 H), 0.85 (t, 6 H). Compound 44: 1H NMR (300 MHz, CDCl3) δ 6.55 (s, 2 H), 5.45 (t, 1 H), 4.4 (m, 2 H), 3.05 (dd, 1 H), 2.85 (dd, 1 H), 2.4 (m, 7 H), 1.65 (s, 3 H), 1.6 (s, 3 H), 1.55 (m, 2 H), 1.4 (m, 4 H), 1.1 (m, 4 H), 1.1 (d, 3 H), 0.9 (t, 6 H).
- Compound 8 (1.85 g, 6 mmol) was dissolved in dichloromethane (20 mL) and cooled to −78° C., followed by the addition of boron tribromide (6 mL of a 1 M solution, 6 mmol, 1 eq.). The reaction mixture was stirred at −78° C. for 1 hr and then warmed to room temperature for 2 hrs. The reaction was quenched with methanol (5 mL), and the solvent was evaporated (methanol quench repeated twice more). The resulting oil was dried overnight under high vacuum (5 mm Hg). The residue was dissolved in dichloromethane and NaHCO3 was added, mixed thoroughly, and the organic layer was separated, dried with MgSO4, filtered and the solvent evaporated to a mixture of two regioisomers 45 and 46 (1:1). The purification of a mixture (200 mg) was conducted on a reverse phase HPLC (C18 column, 69:30:1/water:acetonitrile:triflouroacetic acid) to afford 45 and 46 as triflouroacetate salts. Compound 45 (TFA salt): 1H NMR (300 MHz, CDCl3) δ 6.65 (q, 2H), 4.7 (bs, 1 H), 3.7 (s, 3 H), 3.5 (m, 1 H), 3.3 (m, 1 H), 3.0 (m, 4H), 2.7 (m, 2 H), 2.3 (m, 1 H), 2.0 (m, 5 H), 1.15 (d, 3 H), 0.9 (m, 6 H). Compound 46 (free base): 1H NMR (300 MHz, CDCl3) δ 6.55 (q, 2 H), 4.3 (bs, 1 H), 3.75 (s, 3 H), 3.05 (dd, 1 H), 3.0 (dd, 1 H), 2.6 (m, 1 H), 2.4 (m, 6 H), 2.2 (m, 1 H), 1.8 (m, 1 H), 1.4 (m, 4 H), 1.1 (d, 3 H), 0.85 (t, 6 H). The regiochemistry of the structure of 46 was confirmed through careful analysis of HMBC (Heteronuclear Multiple Bond Correlation) connectivities and nOe effects. The structure of 46 was established by connectivity between the methoxy substituent on the aromatic ring and the benzylic methylene adjacent to the methyl-substituted carbon.
- Ketone 6 (1 g, 4.5 mmol) was dissolved in acetonitrile (75 mL) and acetic acid (0.54 mL, 9 mmol, 2 eq.), and alanine methyl ester hydrochloride (1.3 g, 9 mmol, 2 eq.) was added. The reaction was stirred at room temperature for 1 hr, and then sodium cyanoborohydride (0.6 g, 9 mmol, 2 eq.) was added portionwise (3×) over 1.5 hrs (every 30 min). The reaction was stirred overnight at room temperature. Ethyl acetate and 1 N NaOH were added with thorough mixing and the organic layer was separated, dried with MgSO4, filtered and evaporated to an oil. The product was purified with flash chromatography (50:50/ethyl acetate:hexane) to yield 48 as an oil. Compound 48, (mixture of cis and trans stereoisomers) 1H NMR (300 MHz, CDCl3) δ 6.64 (d, 2 h), 4.2 (m, 1 H), 3.85 (m, 3 H, 3.75 (s, 6 H), 3.5 (m, 1 H), 3.1 (m, 2 H), 2.8 (m, 2H), 2.55 (m, 1 H), 2.3 (m, 1 H), 1.7 (m, 3 H), 1.2 (m, 3 H).
- Compound 48 (0.28 g, 0.8 mmol) was dissolved in acetonitrile along with propionaldehyde (0.1 mL, 1.6 mmol, 2 eq.) and acetic acid (0.2 mL, 1.6 mmol), and stirred for 1 hr at room temperature. One hour later, sodium cyanoborohydride (0.2 g, 1.6 mmol, 2 eq.) was added portionwise (3×) over a period of 1.5 hrs (every 30 minutes). The reaction was stirred overnight at room temperature. Ethyl acetate and 1 N NaOH were added to the reaction with thorough mixing and the organic layer was separated, dried with MgSO4, filtered and evaporated to an oil. This material was purified using flash chromatography (flash silica, 80:20/hexane:ether) to afford (1:1 mixture of cis and trans stereoisomers) 47. 1H NMR (300 MHz, CDCl3) δ 6.6 (d, 2 H), 3.75 (s, 6 H), 3.7 (d, 4 H), 3.0 (m, 2 H), 2.65 (m, 3 H), 2.2 (m, 1 H), 1.7 (m, 2 H), 1.45 (m, 2 H), 1.25 (d, 3 H), 1.0 (m, 3 H), 0.8 (t, 3 H).
- Compound 9 (0.5 g, 2.0 mmol) was dissolved in dioxane (100 mL) at 0° C. Triethylamine (6 mL) was added and the reaction mixture was stirred at 0° C. for 30 mins, followed by the addition of diphenylphosphinyl chloride (0.84 mL, 4.4 mmol). The reaction mixture was stirred overnight at room temperature. NaHCO3 and dichloromethane were then added with thorough mixing. The organic layer was separated, dried with MgSO4, filtered and the solvent was evaporated to a crude oil which was purified by flash chromatography (flash silica, 70:30/hexane:ether) to yield 59 and 58. Compound 59: 1H NMR (300 MHz, CDCl3) δ 7.85 (d, 4 H), 7.8 (d, 4 H), 7.5 (m, 12 H), 6.8 (q, 2 H), 3.0 (m, 2 H), 2.4 (m, 7 H), 1.8 (m, 1 H), 1.4 (m, 4 H), 1.05 (d, 3 H), 0.85 (t, 6 H). Compound 58 (1:1 mix of regioisomers): 1H NMR (300 MHz, CDCl3) δ 7.85 (m, 4 H), 7.5 (m, 6 H), 6.6 (q, 1 H), 6.48 (s, 1 H), 6.21 (d, 1 H), 2.9 (m, 3 H), 2.3 (m, 9 H), 1.65 (m, 1 H), 1.4 (m, 1 H), 1.05 (d, 3 H), 0.85 (m, 6 H). In a similar manner, starting from 32, was prepared both compounds 57 and 56. In addition, in a similar manner, starting from 9, was prepared compounds 49-51 using the appropriate reagents.
- A solution of 1-(2-chloroethoxy)-4-nitrobenzene (2.01 g, 0.01 mol), piperidine (2.55 g, 0.03 mol), and toluene (10 mL) was refluxed overnight. The reaction mixture was filtered and the filtrate evaporated to give 2.97 g of 1-[2-(1-piperidinyl)ethoxy]4-nitrobenzene as an orange oil, MS M+ (m/e) 251.18. This material (1.25 g, 0.004 mol) was hydrogenated in ethanol (25 mL) in the presence of 10% Pd—C catalyst at 40 psig and 25° C. overnight. Filtration and evaporation of the reaction mixture gave 0.95 g of 4-[2-(1-piperidinyl)ethoxy]aniline as a light brown oil, MS M+ (m/e) 221.24. A solution of this oil (0.220 g, 1.0 mmol), 3-methyl-5,8-dimethoxy-2-tetralone (6, 0.206, 0.94 mmol), and 1,2-dichloroethane (3.5 mL) was treated with sodium triacetoxyborohydride (0.300 g, 1.4 mmol) and acetic acid (0.060 g, 1.0 mmol) and the resulting mixture was stirred overnight at 25° C. The reaction was treated with 3N sodium hydroxide solution with vigorous stirring. The organic layer was separated, washed with saturated sodium chloride solution, dried over potassium carbonate, filtered and evaporated to a red oil. This material was purified by C-18 reverse phase high pressure liquid chromatography affording compound 60 as a pink solid. 1H NMR (300 MHz, CDCl3): δ 7.10-7.22 (m, 2H), 6.52-6.82 (m, 4H), 4.25-4.33 (m, 2H), 3.60-3.80 (m, 3H), 3.75 (s, 3H), 3.71 (s, 3H), 3.48-3.38 (m, 2H), 2.80-3.05 (m, 4H), 1.80-2.10 (m, 4H), 1.10-1.50 (m, 3H), 1.00 (d, 3H). MS M+ (m/e) 425.38.
- The compounds shown in Table 1, below, were prepared according to the procedures described herein.
TABLE 1 MS M+ Cp. R5 R6 R2 R3 Config. (m/e) 9 H H Pr Pr trans 278.24 15 H H Pr Pr trans, ent. 278.25 16 H H Pr Pr trans, ent. 278.21 7 Me Me H Pr trans 8 Me Me Pr Pr trans 306.28 17 Me Me Pr Pr trans, ent. 306.24 18 Me Me Pr Pr trans, ent. 306.27 19 Me Me Pr Ph(CH2)3 trans 382.28 20 H H Pr Ph(CH2)3 trans 354.27 21 Me Me Pr cC6H11CH2 trans 360.32 22 H H Pr cC6H11CH2 trans 332.32 23 Me Me —(CH2)2O(CH2)2— cis 292.66 24 H H —(CH2)2O(CH2)2— cis 264.28 25 Me Me Pr CH2Ph trans 354.74 26 H H Pr CH2Ph trans 326.21 27 Me Me Pr MeS(CH2)3 trans 352.29 28 H H Pr MeS(CH2)3 trans 324.24 29 Me Me Pr (2-thienyl)CH2 trans 360.24 30 H H Pr (2-thienyl)CH2 trans 332.14 31 Me Me Pr CH2CCH trans 302.21 32 H H Pr CH2CCH trans 274.16 33 Me Me Pr CH2CCH cis 302.22 34 H H Pr CH2CCH cis 274.16 35 Me Me Pr CH2(4-IPh) trans 480.11 36 H H Pr CH2(4-IPh) trans 452.14 37 Me Me Pr CH2(4-BuOPh) trans 426.25 38 H H Pr CH2(4-OHPh) trans 342.16 39 Me Me Pr CH2(2-ClPh) trans 388.18 40 H H Pr CH2(2-ClPh) trans 360.12 41 Me Me Pr CH2(4-MePh) trans 368.29 42 H H Pr CH2(4-MePh) trans 340.18 43 H X Pr Pr trans 346.29 44 X H Pr Pr trans 346.30 45 Me H Pr Pr trans 292.22 46 H Me Pr Pr trans 292.22 47 Me Me Pr CH(Me)CO2Me cis & trans 350.26 48 Me Me H CH(Me)CO2Me cis & trans 308.19 49 Y Y Pr Pr trans 446.39 50 H Y Pr Pr trans 362.26 51 Y H Pr Pr trans 362.30 52 Me Me Pr Me trans 278.19 53 H H Pr Me trans 250.18 54 Me Me Pr Z trans 402.28 55 H H Pr Z trans 374.25 56 H X′ Pr CH2CCH trans 474.13 57 X′ X′ Pr CH2CCH trans 674.11 58 H X′ Pr Pr trans 478.21 59 X′ X′ Pr Pr trans 678.11 60 Me Me H Y′ cis 425.38 - As a specific embodiment of an oral composition, 100 mg of Compound 9 from Example 1 is formulated with sufficient finely divided lactose to provide a total amount of 580 to 590 mg to fill a size O hard gel capsule.
- SK-N-MC cell membranes were incubated with 0.5 nM of125I-α-bungarotoxin in the presence of various concentrations of Aβ1-42 and Aβ1-40 at 25° C. for 1 hr. The assay mixture was then rapidly filtered and the radioactivity that was retained on the filter was determined. These studies showed that both Aβ1-42 and Aβ1-40 inhibited 125I-α-bungarotoxin binding in a concentration-dependent manner with IC50 values of 1 pM and 100 pM, respectively.
- Alpha-7 nAChRs were immobilized on wheat germ agglutinin coupled yittrium SPA beads and allowed to incubate with125I-Aβ1-40 in the presence of various concentrations of cold Aβ1-40 or Aβ1-42. The data showed that 0.1 femtoM of cold Aβ1-42 completely abolished the binding, suggesting that Aβ1-42 interacted with alpha-7 nAChRs with high affinity. However, in the presence of 10 nM of cold Aβ1-42, the total binding of 125I-Aβ1-40 to alpha-7 nAChRs was dramatically increased. We attribute this increase of binding at higher concentrations to Aβ1-42-induced precipitation of the Aβ peptides on the membranes. Prolonged incubation at lower concentrations also revealed that total binding was increased in reactions even with 100 pM of cold Aβ1-42. In control experiments, 80 pM 125I-Aβ1-40 did not bind appreciably, along with 1 pM to 1 nM of Aβ1-40, to 30 μg of Bowes melanoma membranes. Thus, Aβ deposition can occur on biological cell membranes containing alpha-7 nAChRs, but does not occur non-specifically on control membranes, suggesting that alpha-7 nAChRs can specifically seed the aggregation of β-amyloid in biological systems.
- Alpha-7 nAChRs were allowed to interact with Aβ1-40 or Aβ1-42 and the mixture was then immunoprecipitated with anti-alpha-7 nAChR antibodies. Western analyses of the immunoprecipitated proteins identified only the presence of Aβ1-42, indicating that the Aβ1-42/alpha-7 nAChR interaction is robust and of high affinity. Since it has already been shown that Aβ1-40 binds to the alpha-7 receptor, the failure in detecting Aβ1-40 in this co-precipitation experiment suggests that the Aβ1-40/alpha-7 nAChR interaction is of lower affinity than the Aβ1-42/alpha-7 nAChR interaction.
- Aβs are known to form aggregates leading to the formation of amyloid plaques that are characteristic of Alzheimer'disease. This phenomenon can be demonstrated in vitro by using Synthaloid plates, coated with Aβ crystallization centers, and labelled Aβs for detecting aggregation. We have validated this aggregation assay using both125I-Aβ1-40 and fluo-Aβ1-40 in a buffer containing 50 mM HEPES, pH 7.4, 0.1% BSA, 10% FCS and protease inhibitors. About 500 pM of 125I-Aβ1-40 or 100 nM of fluo-Aβ1-40 in 100 μl of each well of the 96-well Synthaloid plate was allowed to incubate for 2.5 hr at room temperature in the presence or absence of inhibitors. At the end of the incubation, unbound protein in the wells was removed by three washes using the above buffer. The amount of bound protein which represented Aβ aggregation was measured either by scintillation counting or fluorescence measurements. Compound 9 was found to potently inhibit Aβ aggregation with 10 nM IC50. Time course studies also showed that prolonged incubation of amyloid aggregates with Compound 9 resulted in disaggregation.
- Compounds which inhibit Aβ aggregation with an IC50<100 micromolar may be effective in inhibiting the binding of Aβ to alpha-7 in such a manner as to have a positive therapeutic effect useful for the treatment of neurodegenerative disorders.
- Synaptosomes from guinea pig hippocampus were incubated with 0.1 μM3H-choline and then subjected to repeated washes to remove unincorporated 3H-choline. The synaptosomes were treated with 65 mM K+ for 30 seconds to elicit 3H-acetylcholine release. While Aβ1-40 and Aβ1-42 at 100 pM both inhibited acetylcholine release from these preparations (33% inhibition for both Aβ1-40 and Aβ1-42), pretreatment of the synaptosomes with both 10 nM of Compound 9 and 100 pM of either Aβ1-40 and Aβ1-42 prior to K+ stimulation was found to have no effect on acetylcholine release.
- To determine the effect of compound 9 on125I-Aβ1-40 to alpha-7 nAChRs, alpha-7 nAChR contained SK-N-MC cell membranes were immobilized on wheat germ agglutinin coupled yittrium SPA beads and allowed to incubate with 125I-Aβ1-40 in the presence of various concentrations of compound 9. The result demonstrated that Compound 9 efficiently inhibited the binding of 125I-Aβ1-40 to SK-N-MC cells with a 300 pM IC50. Compounds which inhibit the binding of Aβ to alpha-7 nAChRs with an IC50<1 micromolar may have a positive therapeutic effect useful for the treatment of neurodegenerative disorders.
- A 2-5 ug quantity of the 11 amino acid peptide comprised of the 206-216 stretch of the α7 nAChR (N-Ac, C(O)NH2) are added to a 96-well microtiter plate in 50 mL 10 mM HEPES, pH 7.4, or any buffer 50 ul. 125I-β-amyloid1-40 (2000 Ci/mmol, 50 pM) was added to the wells in the presence and absence of inhibitors (1 uM to 10 uM) dissolved in 1 uL of 30% or 100% DMSO. Unbound ligands were removed and bound radioactivity was measured using a Microbeta liquid scintillation counter. Ligand binding can be inhibited by α-bugarotoxin, the peptide itself, and Compound 9.
- Biological data for representative compounds of the present invention is provided in Table 2 which follows.
TABLE 2 % α7 % ACh nAChR Release at % Inh Agg. 206-216 10 μM Cp. # (conc μM) Binding (IC50, μM) 9 >90 (10) 94 94 (0.1) 15 50-90 (10) 85 (0.25) 16 50-90 (10) 44 (10) 7 50 (100) NT NT 8 50-90 (10) NT (0.7) 17 >90 (10) NT 63 (1) 18 50-90 (10) NT 70 (10) 19 30 (5) NT NT 20 39 (5) NT NT 21 20 (5) NT NT 22 38 (50) NT NT 23 NT 54 NT 24 NT 43 NT 25 NT 48 NT 26 <30 (10) 64 NT 27 NT NT NT 28 50-90 (10) 34 NT 29 12 (10) NT NT 30 38 (5) NT NT 31 34 (10) NT NT 32 69 (10) NT NT 33 NT NT NT 34 69 (10) NT NT 35 38 (10) NT NT 36 <30 (10) NT NT 37 <30 (10) NT NT 38 <30 (10) NT NT 39 85 (10) NT NT 40 75 (10) NT NT 41 <30(10) 19 14 42 60 (10) NT NT 43 50-90 (10) 10 0 44 50-90 (10) 23 0 45 30-50 (78) NT 78 46 50-90 (10) 18 0 47 NT NT NT 48 <30 (10) 2 0 49 50-90 (10) 0 17 50 <30 (10) 0 67 51 30-50 (10) 0 54 52 60 (10) 0 0 53 50-90 (10) 0 18 54 50-90 (10) 0 0 55 50-90 (10) 0 15 56 <30 (10) 78 8 57 <30 (10) 63 11 58 <30 (10) 42 18 59 <30 (10) 72 25 60 very active 0 24 - While the foregoing specification teaches the principles of the present invention, with examples provided for the purpose of illustration, it will be understood that the practice of the invention encompasses all of the usual variations, adaptations and/or modifications as come within the scope of the following claims and their equivalents.
Claims (27)
1. A method of treating a neurodegenerative disorder in a subject in need thereof which comprises administering to the subject an amount of a compound effective to inhibit the binding of an amyloid beta peptide with alpha-7 nicotinic acetylcholine receptors.
2. The method of claim 1 , wherein the alpha-7 nicotinic acetylcholine receptors are human alpha-7 nicotinic acetylcholine receptors.
3. The method of claim 2 , wherein the neurodegenerative disorder is selected from Alzheimer's disease, Pick's disease, diffuse Lewy body disease, progressive supranuclear palsy (Steel-Richardson syndrome), multisystem degeneration (Shy-Drager syndrome), motor neuron diseases including amyotrophic lateral sclerosis, degenerative ataxias, cortical basal degeneration, ALS-Parkinson's-Dementia complex of Guam, subacute sclerosing panencephalitis, Huntington's disease, Parkinson's disease, synucleinopathies, primary progressive aphasia, striatonigral degeneration, Machado-Joseph disease/spinocerebellar ataxia type 3 and olivopontocerebellar degenerations, Gilles De La Tourette's disease, bulbar and pseudobulbar palsy, spinal and spinobulbar muscular atrophy (Kennedy's disease), primary lateral sclerosis, familial spastic paraplegia, Werdnig-Hoffmann disease, Kugelberg-Welander disease, Tay-Sach's disease, Sandhoff disease, familial spastic disease, Wohlfart-Kugelberg-Welander disease, spastic paraparesis, progressive multifocal leukoencephalopathy, and prion diseases (including Creutzfeldt-Jakob, Gerstmann-Sträussler-Scheinker disease, Kuru and fatal familial insomnia, age-related dementia, vascular dementia, diffuse white matter disease (Binswanger's disease), dementia of endocrine or metabolic origin, dementia of head trauma and diffuse brain damage, dementia pugilistica or frontal lobe dementia, neurodegenerative disorders resulting from cerebral ischemia or infaction including embolic occlusion and thrombotic occlusion as well as intracranial hemorrhage of any type, intracranial and intravertebral lesions, hereditary cerebral angiopathy, nonneuropathic hereditary amyloid, Down's syndrome, macroglobulinemia, secondary familial Mediterranean fever, Muckle-Wells syndrome, multiple myeloma, pancreatic- and cardiac-related amyloidosis, chronic hemodialysis arthropathy, or Finnish and Iowa amyloidosis.
4. The method of claim 3 , wherein the amyloid beta peptide is Aβ1-42.
5. The method of claim 3 , wherein the neurodegenerative disorder is Alzheimer's disease.
6. The method of claim 5 , wherein the compound inhibits the binding of Aβ1-42 with the human alpha-7 nicotinic acetylcholine receptor by binding to Aβ1-42.
7. The method of claim 3 , wherein the compound inhibits the binding of Aβ1-42 with the human alpha-7 nicotinic acetylcholine receptor by binding to human alpha-7 nicotinic acetylcholine receptors.
8. The method of claim 3 , wherein the compound inhibits the binding of Aβ1-42 with the human alpha-7 nicotinic acetylcholine receptor by inhibiting aggregation of amyloid beta peptides.
9. The method of claim 5 , wherein the compound is of the formula I
wherein
R1 is hydrogen or C1-C4 alkyl;
R2 is selected from hydrogen, C1-C6 alkyl, aryl or C7-C10 aralkyl;
R3 is selected from hydrogen, C1-C6 alkyl, C3-C10 alkenyl, C3-C8 cycloalkylC1-C6 alkyl, C1-C6 alkoxycarbonylC1-C6 alkyl, C1-C6 alkylthio, heteroarylC1-C4 alkyl, unsubstituted or substituted aryl or unsubstituted or substituted C7-C10 aralkyl wherein the substituent on the aryl or aralkyl are one or more substituents independently selected from the group consisting of halogen, hydroxy, C1-C6 alkyl and unsubstituted or substituted C1-C6 alkoxy wherein the substituents on the alkoxy are one or more substituents independently selected from amino, C1-C6 alkylamino, C1-C6 dialkylamino, pyrrolidinyl, piperidinyl, azepinyl or morpholinyl; or
R2 and R3, together with the nitrogen to which they are attached, form a five or six-membered heterocyclic ring selected from pyrrolidinyl, piperidinyl, morpholinyl, thiomorpholinyl or piperazinyl;
R4 is C1-C6 alkyl, aryl, or C7-C10 aralkyl; and
R5 and R6 are each independently selected from hydrogen, C1-C6 alkyl, C3-C10 alkenyl, C1-C8 alkylcarbonyl, or diphenylphosphinyl; and pharmaceutically acceptable salts and prodrugs thereof.
10. A method of treating and/or preventing dementia in an Alzheimer's disease patient which comprises administering to the subject a therapeutically effective amount of a compound which inhibits the binding of an amyloid beta peptide with alpha-7 nicotinic acetylcholine receptors.
11. The method of claim 10 , wherein the amyloid beta peptide is Aβ1-42 and the alpha-7 nicotinic acetylcholine receptors are human alpha-7 nicotinic acetylcholine receptors.
12. The method of claim 11 , wherein the compound is of the formula I
wherein
R1 is hydrogen or C1-C4 alkyl;
R2 is selected from hydrogen, C1-C6 alkyl, aryl or C7-C10 aralkyl;
R3 is selected from hydrogen, C1-C6 alkyl, C3-C10 alkenyl, C3-C8 cycloalkylC1-C6 alkyl, C1-C6 alkoxycarbonylC1-C6 alkyl, C1-C6 alkylthio, heteroarylC1-C4 alkyl, unsubstituted or substituted aryl or unsubstituted or substituted C7-C10 aralkyl wherein the substituent on the aryl or aralkyl are one or more substituents independently selected from the group consisting of halogen, hydroxy, C1-C6 alkyl and unsubstituted or substituted C1-C6 alkoxy wherein the substituents on the alkoxy are one or more substituents independently selected from amino, C1-C6 alkylamino, C1-C6 dialkylamino, pyrrolidinyl, piperidinyl, azepinyl or morpholinyl; or R2 and R3, together with the nitrogen to which they are attached, form a five or six-membered heterocyclic ring selected from pyrrolidinyl, piperidinyl, morpholinyl, thiomorpholinyl or piperazinyl;
R4 is C1-C6 alkyl, aryl, or C7-C10 aralkyl; and
R5 and R6 are each independently selected from hydrogen, C1-C6 alkyl, C3-C10 alkenyl, C1-C8 alkylcarbonyl, or diphenylphosphinyl; and pharmaceutically acceptable salts and prodrugs thereof.
13. A method of improving memory and/or of halting the progression of mental deterioration in an Alzheimer's disease patient which comprises administering to the subject a therapeutically effective amount of a compound to inhibit the binding of an amyloid beta peptide with alpha-7 nicotinic acetylcholine receptors.
14. The method of claim 13 , wherein the amyloid beta peptide is Aβ1-42 and the alpha-7 nicotinic acetylcholine receptors are human alpha-7 nicotinic acetylcholine receptors.
15. The method of claim 14 , wherein the compound is of the formula I
wherein
R1 is hydrogen or C1-C4 alkyl;
R2 is selected from hydrogen, C1-C6 alkyl, aryl or C7-C10 aralkyl;
R3 is selected from hydrogen, C1-C6 alkyl, C3-C10 alkenyl, C3-C8 cycloalkylC1-C6 alkyl, C1-C6 alkoxycarbonylC1-C6 alkyl, C1-C6 alkylthio, heteroarylC1-C4 alkyl, unsubstituted or substituted aryl or unsubstituted or substituted C7-C10 aralkyl wherein the substituent on the aryl or aralkyl are one or more substituents independently selected from the group consisting of halogen, hydroxy, C1-C6 alkyl and unsubstituted or substituted C1-C6 alkoxy wherein the substituents on the alkoxy are one or more substituents independently selected from amino, C1-C6 alkylamino, C1-C6 dialkylamino, pyrrolidinyl, piperidinyl, azepinyl or morpholinyl; or R2 and R3, together with the nitrogen to which they are attached, form a five or six-membered heterocyclic ring selected from pyrrolidinyl, piperidinyl, morpholinyl, thiomorpholinyl or piperazinyl;
R4 is C1-C6 alkyl, aryl, or C7-C10 aralkyl; and
R5 and R6 are each independently selected from hydrogen, C1-C6 alkyl, C3-C10 alkenyl, C1-C8 alkylcarbonyl, or diphenylphosphinyl; and pharmaceutically acceptable salts and prodrugs thereof.
16. A method for identifying compounds which are useful for the treatment of neurodegenerative disorders involving screening test compounds for their ability to block the interaction of a peptide selected from the group consisting of 125I-Aβ1-40, Aβ1-40 and Aβ1-42 with nicotine acetylcholine receptors.
17. The method of claim 16 , wherein the nicotine acetycholine receptors are human alpha-7, human alpha-8, and/or human alpha-9 nicotinic acetylcholine receptors.
18. The method of claim 17 , wherein the nicotine acetylcholine receptors are human alpha-7 nicotine acetylcholine receptors.
19. The method of claim 18 , wherein the peptide is 125I-Aβ1-40.
20. A compound of the formula I:
wherein
R1 is hydrogen or C1-C4 alkyl;
R2 is selected from hydrogen, C1-C6 alkyl, aryl or C7-C10 aralkyl;
R3 is selected from hydrogen, C1-C6 alkyl, C3-C10 alkenyl, C3-C8 cycloalkylC1-C6 alkyl, C1-C6 alkoxycarbonylC1-C6 alkyl, C1-C6 alkylthio, heteroarylC1-C4 alkyl, unsubstituted or substituted aryl or unsubstituted or substituted C7-C10 aralkyl wherein the substituent on the aryl or aralkyl are one or more substituents independently selected from the group consisting of halogen, hydroxy, C1-C6 alkyl and unsubstituted or substituted C1-C6 alkoxy wherein the substituents on the alkoxy are one or more substituents independently selected from amino, C1-C6 alkylamino, C1-C6 dialkylamino, pyrrolidinyl, piperidinyl, azepinyl or morpholinyl; or
R2 and R3, together with the nitrogen to which they are attached, form a five or six-membered heterocyclic ring selected from pyrrolidinyl, piperidinyl, morpholinyl, thiomorpholinyl or piperazinyl;
R4 is C1-C6 alkyl, aryl, or C7-C10 aralkyl; and
R5 and R6 are each independently selected from hydrogen, C1-C6 alkyl, C3-C10 alkenyl, C1-C8 alkylcarbonyl, or diphenylphosphinyl; and pharmaceutically acceptable salts and prodrugs thereof.
21. The compound of claim 20 , wherein
R1 is hydrogen;
R2 is selected from hydrogen or C1-C4 alkyl;
R3 is selected from C1-C4 alkyl, C3-C10 alkenyl, C5-C6 cycloalkylC1-C46 alkyl, C1-C6 alkoxycarbonylC1-C4 alkyl, C1-C6 alkylthio, heteroarylC1-C4 alkyl, or unsubstituted or substituted C7-C10 aralkyl wherein the substituent on the aralkyl are one or two substituents independently selected from the group consisting of halogen, hydroxy, C1-C4 alkyl and unsubstituted or substituted C1-C4 alkoxy wherein the substituents on the alkoxy are one or two substituents independently selected from amino, C1-C4 alkylamino, C1-C4 dialkylamino, pyrrolidinyl, or piperidinyl; or
R2 and R3, together with the nitrogen to which they are attached, form a morpholinyl ring;
R4 is C1-C4 alkyl; and
R5 and R6 are each independently selected from hydrogen, C1-C4 alkyl, C3-C6 alkenyl, C1-C6 alkylcarbonyl, or diphenylphosphinyl; and pharmaceutically acceptable salts and prodrugs thereof.
23. A compound of claim 22 which is 5,8-dihydroxy-trans-2-di(N-propylamino)-3-methyl-1,2,3,4-tetrahydronaphthalene and pharmaceutically acceptable salts and prodrugs thereof.
24. A pharmaceutical composition comprising a pharmaceutically acceptable carrier and a compound of claim 20 .
25. A pharmaceutical composition made by mixing a compound of claim 20 and a pharmaceutically acceptable carrier.
26. A process for making a pharmaceutical composition comprising mixing a compound of claim 20 and a pharmaceutically acceptable carrier.
27. A method for diagnosing Alzheimer's disease, monitoring the progression and prognosis of Alzheimer's disease and/or monitoring the therapeutic efficacy of any intervention or treatment of Alzheimer's disease comprising:
(a) obtaining a test sample from a subject wherein the test sample comprises circulating blood cells and/or olfactory neuroepithelial neuronal cell bodies or their neuronal processes; and
(b) analyzing the test sample for interaction of an amyloid beta peptide with alpha-7 nicotinic acetylcholine receptors.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US09/320,885 US6441049B2 (en) | 1998-06-01 | 1999-05-27 | Method of treating neurodegenerative disorders via inhibition of amyloid beta peptide binding |
US10/162,821 US7018797B2 (en) | 1998-06-01 | 2002-06-05 | Method for treating neurodegenerative disorders |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US8757798P | 1998-06-01 | 1998-06-01 | |
US09/320,885 US6441049B2 (en) | 1998-06-01 | 1999-05-27 | Method of treating neurodegenerative disorders via inhibition of amyloid beta peptide binding |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/162,821 Division US7018797B2 (en) | 1998-06-01 | 2002-06-05 | Method for treating neurodegenerative disorders |
Publications (2)
Publication Number | Publication Date |
---|---|
US20020013374A1 true US20020013374A1 (en) | 2002-01-31 |
US6441049B2 US6441049B2 (en) | 2002-08-27 |
Family
ID=22206004
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/320,885 Expired - Lifetime US6441049B2 (en) | 1998-06-01 | 1999-05-27 | Method of treating neurodegenerative disorders via inhibition of amyloid beta peptide binding |
US10/162,821 Expired - Lifetime US7018797B2 (en) | 1998-06-01 | 2002-06-05 | Method for treating neurodegenerative disorders |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/162,821 Expired - Lifetime US7018797B2 (en) | 1998-06-01 | 2002-06-05 | Method for treating neurodegenerative disorders |
Country Status (12)
Country | Link |
---|---|
US (2) | US6441049B2 (en) |
EP (1) | EP1083889B1 (en) |
JP (1) | JP4637351B2 (en) |
AR (1) | AR018431A1 (en) |
AT (1) | ATE255888T1 (en) |
AU (1) | AU765142B2 (en) |
CA (1) | CA2333951C (en) |
DE (1) | DE69913520T2 (en) |
DK (1) | DK1083889T3 (en) |
ES (1) | ES2212570T3 (en) |
PT (1) | PT1083889E (en) |
WO (1) | WO1999062505A2 (en) |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2004074973A3 (en) * | 2003-02-19 | 2004-11-18 | Balin Advertising Ltd | A system for providing private offers to customers of web sites |
US20050170360A1 (en) * | 2004-01-30 | 2005-08-04 | Papke Roger L. | Variant neuronal nicotinic alpha-7 receptor and methods of use |
WO2008020131A1 (en) * | 2006-08-18 | 2008-02-21 | Les Laboratoires Servier | Method of screening for compounds with anti-amyloid properties |
US20140017699A1 (en) * | 2012-07-13 | 2014-01-16 | Hoau-Yan Wang | Alzheimer's disease assay in a living patient |
US20160011208A1 (en) * | 2013-02-27 | 2016-01-14 | Damian C. CROWTHER | Assay for polypeptide aggregation using microdroplets |
US20210389298A1 (en) * | 2012-07-13 | 2021-12-16 | Pain Therapeutics, Inc. | Alzheimer's Disease Assay in a Living Patient |
Families Citing this family (65)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7214686B2 (en) | 1997-06-30 | 2007-05-08 | Targacept, Inc. | Pharmaceutical compositions and methods for effecting dopamine release |
GB9923078D0 (en) * | 1999-09-29 | 1999-12-01 | Phytopharm Plc | Sapogenin derivatives and their use |
US8188043B2 (en) | 1999-07-28 | 2012-05-29 | The Board Of Trustees Of The Leland Stanford Jr. University | Nicotine in therapeutic angiogenesis and vasculogenesis |
ES2250170T3 (en) * | 1999-07-28 | 2006-04-16 | Ortho-Mcneil Pharmaceutical, Inc. | DERIVATIVES OF AMINAS AND AMIDAS USED AS BINDING FOR THE Y5 RECEPTOR OF THE NEUROPEPTIDE AND, USEFUL IN THE TREATMENT OF OBESITY AND OTHER DISORDERS. |
IL150374A0 (en) * | 1999-12-23 | 2002-12-01 | Neurochem Inc | Compounds and methods for modulating cerebral amyloid angiopathy |
JP2001261652A (en) | 2000-03-21 | 2001-09-26 | Suntory Ltd | Disubstituted iminoheterocyclic compound |
GB2364385B (en) * | 2000-03-29 | 2002-08-14 | Synaptica Ltd | Alpha 7 nicotinic receptor screening assays |
WO2001089453A2 (en) * | 2000-05-19 | 2001-11-29 | Wayne State University | Derivatives of 2-aminotetralins and pharmaceutical analogs thereof exhibiting differential cns receptor activity and behavior |
US20030092613A1 (en) * | 2000-08-14 | 2003-05-15 | Lee Daniel H. S. | Alpha7 nicotinic receptor peptides as ligands for beta amyloid peptides |
CA2462453C (en) | 2001-10-02 | 2009-07-28 | Pharmacia & Upjohn Company | Azabicyclic-substituted fused-heteroaryl compounds for the treatment of disease |
EP1442037A1 (en) | 2001-11-09 | 2004-08-04 | PHARMACIA & UPJOHN COMPANY | Azabicyclic-phenyl-fused-heterocyclic compounds and their use as alpha7 nachr ligands |
JP2005538683A (en) | 2001-12-14 | 2005-12-22 | ターガセプト,インコーポレイテッド | Methods and compositions for treatment of central nervous system disorders |
DE10164139A1 (en) | 2001-12-27 | 2003-07-10 | Bayer Ag | 2-heteroaryl carboxamides |
US7045534B2 (en) * | 2002-02-12 | 2006-05-16 | The Board Of Trustees Of The Leland Stanford Junior University | Methods of reducing angiogenesis |
BR0307782A (en) * | 2002-02-19 | 2005-01-04 | Upjohn Co | Azabicycle compounds for the treatment of disease |
WO2003070732A1 (en) * | 2002-02-19 | 2003-08-28 | Pharmacia & Upjohn Company | Fused bicyclic-n-bridged-heteroaromatic carboxamides for the treatment of disease |
WO2004019943A1 (en) | 2002-08-30 | 2004-03-11 | Memory Pharmaceuticals Corporation | Anabaseine derivatives useful in the treatment of neurodegenerative diseases |
ES2405594T3 (en) | 2002-09-25 | 2013-05-31 | Memory Pharmaceuticals Corporation | Idazoles, benzothiazoles and benzisothiazoles, and preparation and uses thereof |
EP1562959A2 (en) * | 2002-11-01 | 2005-08-17 | Pharmacia & Upjohn Company LLC | Compounds having both alpha7 nachr agonist and 5ht antagonist activity for treatment of cns diseases |
US7238715B2 (en) * | 2002-12-06 | 2007-07-03 | The Feinstein Institute For Medical Research | Treatment of pancreatitis using alpha 7 receptor-binding cholinergic agonists |
CN102657651A (en) * | 2002-12-06 | 2012-09-12 | 范因斯坦医学研究院 | Inhibition of inflammation using alpha 7 receptor-binding cholinergic agonists |
DE10303974A1 (en) | 2003-01-31 | 2004-08-05 | Abbott Gmbh & Co. Kg | Amyloid β (1-42) oligomers, process for their preparation and their use |
MXPA05012350A (en) * | 2003-05-20 | 2006-05-25 | Transtech Pharma Inc | Rage antagonists as agents to reverse amyloidosis and diseases associated therewith. |
WO2005013910A2 (en) * | 2003-08-07 | 2005-02-17 | University Of South Florida | Cholinergic modulation of microglial activation via alpha-7 nicotinic receptors |
ATE451368T1 (en) | 2003-10-15 | 2009-12-15 | Targacept Inc | AZABICYCLIC COMPOUNDS FOR RELIEVING PAIN AND TREATING CENTRAL NERVOUS SYSTEM DISEASES |
EP1541547A1 (en) * | 2003-12-11 | 2005-06-15 | Newron Pharmaceuticals S.p.A. | Hydroxylamine derivatives |
DE102004014841B4 (en) * | 2004-03-24 | 2006-07-06 | Schwarz Pharma Ag | Use of rotigotine for the treatment and prevention of Parkinson-Plus syndrome |
CN103724343A (en) | 2004-03-25 | 2014-04-16 | 记忆药物公司 | Indazoles, benzothiazoles, benzoisothiazoles, benzisoxazoles, and preparation and uses thereof |
US7678823B2 (en) | 2004-10-04 | 2010-03-16 | Myriad Pharmaceticals, Inc. | Compounds for alzheimer's disease |
US9216966B2 (en) | 2004-10-04 | 2015-12-22 | John Manfredi | Compounds for Alzheimer's disease |
WO2007024814A1 (en) | 2005-08-22 | 2007-03-01 | Targacept, Inc. | HETEROARYL-SUBSTiTUTED DIAZATRICYCLOALKANES, METHODS FOR ITS PREPARATION AND USE THEREOF |
EP1928827B1 (en) * | 2005-09-27 | 2012-08-22 | Myriad Genetics, Inc. | Pyrrole derivatives as therapeutic compounds |
US8316104B2 (en) | 2005-11-15 | 2012-11-20 | California Institute Of Technology | Method and apparatus for collaborative system |
EP1954718B1 (en) | 2005-11-30 | 2014-09-03 | AbbVie Inc. | Anti-a globulomer antibodies, antigen-binding moieties thereof, corresponding hybridomas, nucleic acids, vectors, host cells, methods of producing said antibodies, compositions comprising said antibodies, uses of said antibodies and methods of using said antibodies |
PT1976877E (en) | 2005-11-30 | 2014-04-29 | Abbvie Inc | Monoclonal antibodies against amyloid beta protein and uses thereof |
KR20080081175A (en) * | 2005-12-19 | 2008-09-08 | 코멘티스, 인코포레이티드 | Topical mecamylamine formulations for ocular administration and uses thereof |
US8846937B2 (en) | 2006-06-16 | 2014-09-30 | University Of Kentucky Research Foundation | Mono quaternary ammonium salts and methods for modulating neuronal nicotinic acetylcholine receptors |
CA2662870A1 (en) * | 2006-09-07 | 2008-03-13 | Myriad Genetics, Inc. | Therapeutic compounds for diseases and disorders |
US8314119B2 (en) | 2006-11-06 | 2012-11-20 | Abbvie Inc. | Azaadamantane derivatives and methods of use |
US8455626B2 (en) | 2006-11-30 | 2013-06-04 | Abbott Laboratories | Aβ conformer selective anti-aβ globulomer monoclonal antibodies |
TW200901974A (en) | 2007-01-16 | 2009-01-16 | Wyeth Corp | Compounds, compositions, and methods of making and using them |
US20100311767A1 (en) | 2007-02-27 | 2010-12-09 | Abbott Gmbh & Co. Kg | Method for the treatment of amyloidoses |
SA08290475B1 (en) | 2007-08-02 | 2013-06-22 | Targacept Inc | (2S,3R)-N-(2-((3-Pyridinyl)Methyl)-1-Azabicyclo[2.2.2]Oct-3-yl)Benzofuran-2-Carboxamide, Novel Salt forms, and Methods of Use Thereof |
WO2009046025A1 (en) | 2007-10-01 | 2009-04-09 | Comentis, Inc. | Quinuclidin-4-ylmethyl 1h-indole-3-carboxylate derivatives as alpha 7 nicotinic acetylcholine receptor ligands for the treatment of alzheimer's disease |
SG188144A1 (en) | 2008-02-13 | 2013-03-28 | Targacept Inc | Alpha 7 nicotinic agonists and antipsychotics |
TW201031664A (en) | 2009-01-26 | 2010-09-01 | Targacept Inc | Preparation and therapeutic applications of (2S,3R)-N-2-((3-pyridinyl)methyl)-1-azabicyclo[2.2.2]oct-3-yl)-3,5-difluorobenzamide |
TWI517850B (en) | 2009-09-30 | 2016-01-21 | Vtv治療有限責任公司 | Substituted imidazole derivatives and methods of use thereof |
JP2013523182A (en) | 2010-04-15 | 2013-06-17 | アボット・ラボラトリーズ | Amyloid beta-binding protein |
DE102010020553A1 (en) | 2010-05-14 | 2011-11-17 | Bayer Schering Pharma Aktiengesellschaft | Substituted 8-alkoxy-2-aminotetralin derivatives and their use |
CN103221411B (en) | 2010-05-17 | 2016-05-11 | 富瑞姆制药公司 | (R) crystal formation of the chloro-N-of-7-(quinuclidine-3-yl) benzo [b] thiophene-2-carboxamide derivatives hydrochloride monohydrate |
EP2603524A1 (en) | 2010-08-14 | 2013-06-19 | AbbVie Inc. | Amyloid-beta binding proteins |
CN106074548A (en) | 2010-09-23 | 2016-11-09 | 艾伯维巴哈马有限公司 | The monohydrate of azaadamantane derivatives |
FR2966827B1 (en) | 2010-10-27 | 2014-08-22 | Kimonella Ventures Ltd | PEPTIDE COMPOUND USEFUL FOR INHIBITING AMYLOID PLATE FORMATION |
EP2808679A4 (en) * | 2012-01-27 | 2015-01-14 | Panasonic Healthcare Co Ltd | Diagnosis method and diagnosis system for alzheimer's disease |
CA2872005A1 (en) | 2012-05-08 | 2013-11-14 | Forum Pharmaceuticals, Inc. | Methods of maintaining, treating or improving cognitive function |
PE20150350A1 (en) | 2012-07-20 | 2015-02-28 | Bayer Pharma AG | NOVEL 5-AMINOTETRAHYDROQUINOLIN-2-CARBOXYL ACIDS AND THEIR USE |
WO2014012935A1 (en) | 2012-07-20 | 2014-01-23 | Bayer Pharma Aktiengesellschaft | Substituted aminoindane- and aminotetralincarboxylic acids and use thereof |
US9717710B2 (en) | 2012-10-05 | 2017-08-01 | Vtv Therapeutics Llc | Treatment of mild and moderate Alzheimer's disease |
WO2016007630A1 (en) | 2014-07-11 | 2016-01-14 | Alpharmagen, Llc | Quinuclidine compounds for modulating alpha7 -nicotinic acetylcholine receptor activity |
US9724340B2 (en) | 2015-07-31 | 2017-08-08 | Attenua, Inc. | Antitussive compositions and methods |
WO2018067662A1 (en) * | 2016-10-04 | 2018-04-12 | University Of Miami | Protein amyloidogenesis and related methods |
WO2019190823A1 (en) | 2018-03-28 | 2019-10-03 | Vtv Therapeutics Llc | Pharmaceutically acceptable salts of [3-(4- {2-butyl-1-[4-(4-chlorophenoxy)-phenyl]-1h-imidazol-4-yl} -phenoxy)-propyl]-diethyl-amine |
WO2019190822A1 (en) | 2018-03-28 | 2019-10-03 | Vtv Therapeutics Llc | Crystalline forms of [3-(4- {2-butyl-1-[4-(4-chloro-phenoxy)-phenyl]-1h-imidazol-4-yl} -phenoxy)-propyl]-diethyl-amine |
EP3864008A1 (en) | 2018-10-10 | 2021-08-18 | vTv Therapeutics LLC | Metabolites of [3-(4-{2-butyl-l-[4-(4-chloro-phenoxy)-phenyl]-lh-imidazol-4-yl } -phen ox y)-prop yl] -diethyl-amine |
CU24626B1 (en) | 2019-12-26 | 2022-11-07 | Centro Nac De Biopreparados | PHARMACEUTICAL COMPOSITION BASED ON PROTEINS WITH NEUROPROTECTIVE, IMMUNOMODULATORY, ANTI-INFLAMMATORY AND ANTIMICROBIAL ACTIVITIES |
Family Cites Families (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CH637363A5 (en) * | 1977-11-24 | 1983-07-29 | Sandoz Ag | Process for preparing novel 2-aminotetralins |
DE3831888A1 (en) * | 1988-09-20 | 1990-03-29 | Troponwerke Gmbh & Co Kg | MEDICINES FOR TREATING APOPLEXIA CEREBRI |
US5554601A (en) | 1993-11-05 | 1996-09-10 | University Of Florida | Methods for neuroprotection |
US6689574B1 (en) * | 1997-10-07 | 2004-02-10 | Merck & Co., Inc. | Assays for nuclear receptor agonists and antagonists using fluorescence resonance energy transfer |
US6329159B1 (en) * | 1999-03-11 | 2001-12-11 | Millennium Pharmaceuticals, Inc. | Anti-GPR-9-6 antibodies and methods of identifying agents which modulate GPR-9-6 function |
US6689578B2 (en) * | 2001-12-06 | 2004-02-10 | Paradigm Genetics, Inc. | Methods for the identification of inhibitors of 5-aminolevulinate synthase as antibiotics |
-
1999
- 1999-05-27 DK DK99928342T patent/DK1083889T3/en active
- 1999-05-27 CA CA2333951A patent/CA2333951C/en not_active Expired - Lifetime
- 1999-05-27 DE DE69913520T patent/DE69913520T2/en not_active Expired - Lifetime
- 1999-05-27 AT AT99928342T patent/ATE255888T1/en active
- 1999-05-27 AU AU45433/99A patent/AU765142B2/en not_active Expired
- 1999-05-27 US US09/320,885 patent/US6441049B2/en not_active Expired - Lifetime
- 1999-05-27 EP EP99928342A patent/EP1083889B1/en not_active Expired - Lifetime
- 1999-05-27 WO PCT/US1999/011702 patent/WO1999062505A2/en active IP Right Grant
- 1999-05-27 PT PT99928342T patent/PT1083889E/en unknown
- 1999-05-27 JP JP2000551761A patent/JP4637351B2/en not_active Expired - Fee Related
- 1999-05-27 ES ES99928342T patent/ES2212570T3/en not_active Expired - Lifetime
- 1999-06-01 AR ARP990102580A patent/AR018431A1/en unknown
-
2002
- 2002-06-05 US US10/162,821 patent/US7018797B2/en not_active Expired - Lifetime
Cited By (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2004074973A3 (en) * | 2003-02-19 | 2004-11-18 | Balin Advertising Ltd | A system for providing private offers to customers of web sites |
US20060149618A1 (en) * | 2003-02-19 | 2006-07-06 | Michael Balin | System for providing private offers to customers of web sites |
US20050170360A1 (en) * | 2004-01-30 | 2005-08-04 | Papke Roger L. | Variant neuronal nicotinic alpha-7 receptor and methods of use |
WO2008020131A1 (en) * | 2006-08-18 | 2008-02-21 | Les Laboratoires Servier | Method of screening for compounds with anti-amyloid properties |
FR2905009A1 (en) * | 2006-08-18 | 2008-02-22 | Servier Lab | METHOD OF SCREENING COMPOUNDS WITH ANTI-AMYLOID PROPERTIES |
US20100197740A1 (en) * | 2006-08-18 | 2010-08-05 | Les Laboratoires Servier | Method of Screening Compounds Having Anti-Amyloid Properties |
US20140017699A1 (en) * | 2012-07-13 | 2014-01-16 | Hoau-Yan Wang | Alzheimer's disease assay in a living patient |
US20140017698A1 (en) * | 2012-07-13 | 2014-01-16 | Hoau-Yan Wang | Alzheimer's disease assay in a living patient |
US9354223B2 (en) * | 2012-07-13 | 2016-05-31 | Pain Therapeutics Inc. | Alzheimer's disease assay in a living patient |
US9500640B2 (en) * | 2012-07-13 | 2016-11-22 | Pain Therapeutics, Inc. | Alzheimer's disease assay in a living patient |
US10222368B2 (en) | 2012-07-13 | 2019-03-05 | Pain Therapeutics, Inc. | Alzheimer's disease assay in a living patient |
US20210389298A1 (en) * | 2012-07-13 | 2021-12-16 | Pain Therapeutics, Inc. | Alzheimer's Disease Assay in a Living Patient |
US11385221B2 (en) | 2012-07-13 | 2022-07-12 | Pain Therapeutics, Inc. | Alzheimer's disease assay in a living patient |
US20160011208A1 (en) * | 2013-02-27 | 2016-01-14 | Damian C. CROWTHER | Assay for polypeptide aggregation using microdroplets |
Also Published As
Publication number | Publication date |
---|---|
WO1999062505A3 (en) | 2000-04-06 |
EP1083889A2 (en) | 2001-03-21 |
AR018431A1 (en) | 2001-11-14 |
DE69913520T2 (en) | 2004-11-25 |
JP4637351B2 (en) | 2011-02-23 |
CA2333951C (en) | 2012-02-28 |
DK1083889T3 (en) | 2004-04-13 |
AU4543399A (en) | 1999-12-20 |
US20030130165A1 (en) | 2003-07-10 |
US6441049B2 (en) | 2002-08-27 |
JP2002516853A (en) | 2002-06-11 |
ES2212570T3 (en) | 2004-07-16 |
WO1999062505A2 (en) | 1999-12-09 |
US7018797B2 (en) | 2006-03-28 |
PT1083889E (en) | 2004-04-30 |
DE69913520D1 (en) | 2004-01-22 |
EP1083889B1 (en) | 2003-12-10 |
AU765142B2 (en) | 2003-09-11 |
CA2333951A1 (en) | 1999-12-09 |
ATE255888T1 (en) | 2003-12-15 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US6441049B2 (en) | Method of treating neurodegenerative disorders via inhibition of amyloid beta peptide binding | |
US9708309B2 (en) | Arylcyclopropylamine based demethylase inhibitors of LSD1 and their medical use | |
HUE025704T2 (en) | Oxidated derivatives of triazolylpurines useful as ligands of the adenosine a2a receptor and their use as medicaments | |
RU2595720C2 (en) | Cognitive ability reduction inhibitors | |
JP6302929B2 (en) | Hydroxy aliphatic substituted phenylaminoalkyl ether derivatives | |
EP2061755A1 (en) | Tricyclic compounds useful in treating iron disorders | |
HU218941B (en) | Ethanolamine derivatives having sympathomimetic and anti-pollakiuria activity, pharmaceutical compositions containing them and process for preparing them | |
US20220106330A1 (en) | Solid forms of a promoter of spinogenesis | |
EP2670402B1 (en) | Isolated compounds from turmeric oil and methods of use | |
KR20030017554A (en) | Use of pamoic acid or one of its derivatives, or one of its analogues, for the preparation of a medicament for the treatment of diseases characterised by deposits of amyloid aggregates | |
US6498196B1 (en) | Compounds useful in pain management | |
JP2009528380A (en) | Compounds that suppress the production of β-amyloid | |
KR20090019847A (en) | Pyrrolidine derivatives having activity at the glyt1 transporter | |
JP2007534616A (en) | Tacrine derivatives as inhibitors of acetylcholinesterase | |
MXPA00011847A (en) | Method for treating neurodegenerative disorders | |
US20170049723A1 (en) | Isolated compounds from turmeric oil and methods of use | |
JP2023507180A (en) | OGA inhibitor compounds | |
CN116531381A (en) | Sulfur-containing compound and pharmaceutical composition thereof | |
EA041727B1 (en) | BIPHENILAMIDES CONTAINING MODIFIED ETHER GROUPS AS HSP90 INHIBITORS AND HSP70 STIMULANTS |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: ORTHO-MCNEIL PHARMACEUTICAL, INC., NEW JERSEY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:REITZ, ALLEN B.;DEMETER, DAVID A.;LEE, DANIEL H.S.;AND OTHERS;REEL/FRAME:010089/0526;SIGNING DATES FROM 19990601 TO 19990609 |
|
STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
FPAY | Fee payment |
Year of fee payment: 4 |
|
FPAY | Fee payment |
Year of fee payment: 8 |
|
FPAY | Fee payment |
Year of fee payment: 12 |