CN102399283A - Mink growth hormone releasing hormone cDNA and application thereof - Google Patents
Mink growth hormone releasing hormone cDNA and application thereof Download PDFInfo
- Publication number
- CN102399283A CN102399283A CN2010102863661A CN201010286366A CN102399283A CN 102399283 A CN102399283 A CN 102399283A CN 2010102863661 A CN2010102863661 A CN 2010102863661A CN 201010286366 A CN201010286366 A CN 201010286366A CN 102399283 A CN102399283 A CN 102399283A
- Authority
- CN
- China
- Prior art keywords
- growth hormone
- mink
- cdna
- hormone releasing
- releasing hormone
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Images
Abstract
The invention discloses a full-length nucleotide sequence and a mature peptide nucleotide sequence of a mink growth hormone releasing hormone cDNA gene, and encoded protein amino acid sequences thereof. The mink growth hormone releasing hormone cDNA sequence is a complete open reading frame with 321 nucleotide sequences, and 106 amino acids are encoded. The mature peptide is encoded by 132 nucleotide sequences, and 44 amino acid residues are encoded. The mink growth hormone releasing hormone cDNA can be used for promoting the growths of economic animals such as minks.
Description
Technical field
The present invention relates to clone the Mink Growth Hormone releasing hormone cDNA and the application thereof of acquisition.
Background technology
Mink is the very high fur-bearing animal of a kind of economic worth, and its growth is produced by hypophysis mainly and the tethelin of release is controlled, and after reaching body maturation, the generation of tethelin and release reduce thereupon.And tethelin receives the growth hormone releasing hormone of the hypothalamus generation of animal own and the dual control of Stilamin.Wherein growth hormone releasing hormone promotes hypophysis to produce and growth hormone releasing, and Stilamin then suppresses the generation of tethelin.The two coordinative role is kept the speed of growth of mink jointly.Growth hormone releasing hormone produces at the arcuate nucleus and the ventromedial nucleus of hypothalamus, promptly arrives median eminence through aixs cylinder transportation justacrine after synthesizing, and arrives adenohypophysis through hypophyseal portal system thus.Stimulate adenohypophysis to produce tethelin then.Growth hormone releasing hormone with the people is that example is explained: the polypeptied chain that the precursor of human growth hormone releasing hormone is made up of 108 amino-acid residues; Wherein to hold preceding 20 amino-acid residues be signal peptide sequence to N; When wearing film, excised; Through reprocessing, sophisticated human growth hormone releasing hormone contains 44 amino-acid residues, and the order of 44 peptides is: NH
2-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-COOH.This maturation protein arrives adenohypophysis through hypophyseal portal system; And with the film of eosinophil of secretion GH on GHRH acceptor (GHRH-RP) combine; Activate a kind of after GHRH and the receptors bind earlier to Toxins,exo-, cholera sensitive G s albumen; And then the adenylate cyclase on the Gs activated membrane (AC), make ATP change cAMP into, cause the cAMP level to rise.And the rising of cAMP level can promote the change and the activation of the adjusting subunit conformation of cAMP dependence protein kinase enzyme A, promotes the phosphorylation of GAP-associated protein GAP, and then has influence on cell activity.The GH secretion that cAMP causes has Ca
2+Dependency when GHRH affacts the growth hormone secretion cell, can make Ca in 60 seconds
2+Concentration improve, thereby promote the GH secretion.Evidence suggests Ca
2+Blocking-up can stop the release action of cAMP to GH.This shows that GHRH is through cAMP and Ca to the secretion of GH
2+Mediation, regulate the synthetic of GH and discharge through this process
[1]Discharge because GHRH is pulsed, the GH of corresponding hypophysis also is the pulsed fluctuation.
Growth hormone releasing hormone (GHRH) is generally 44 amino acid whose polypeptide, and complete BA is decided by amino acid whose 1-29 amino acid, and transformation period 7-50 minute, the weak point of visible its action time.The growth hormone releasing hormone molecular size of different animals is slightly different, and the activity form that the GHRH albumen of several kinds of animals such as pig, ox, dog, people and sheep plays a role is the little peptide of 44 amino-acid residues.Their homology is very high.As follows:
Dog: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNREQGAKVRL
Pig: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL
Ox: YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL
People: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Sheep: YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL
The size of the cDNA nucleotide sequence of corresponding different animals growth hormone releasing hormone is also different, and people's growth hormone releasing hormone comes out as far back as 1974 separated purifying and evaluation
[2]The growth hormone releasing hormone cDNA gene that at present a lot of animals comprise the people is by the clone and make public.People's cDNA sequence is 327 Nucleotide, mouse 312, and rat 315, dog, ox, pig are 321.Most sequences have all been carried out patent protection.As:
Chinese patent 02100065.4 has been protected cDNA gene and the application of expression product thereof of the growth hormone releasing hormone of sheep.
00813372.7 (porcine growth hormone releasing hormone analog of super-active) protected Nucleotide and the aminoacid sequence of the pig GHRH that has optimized.
03822291.4 (GHRH analogue) protected nucleotide sequence and the amino acid of the people GHRH that has optimized.
200610017214.5 protected the GHRH medicine and the preparation method that promote piglet growth, improve pigling immunity.
200510061609.0 protected a kind of GHRH medicine and preparation thereof that can promote that human body grows tall.
200710068659.0 having protected pilose antler promotes growth releasing hormone (DEER GHRF) extracts and preparation method thereof.
CN1615151 (being used to treat individual plasmid-mediated the replenishing of chronic disease) and CN1649496 (changing the individual lean mass and the compsn and the method for bone characteristic) have protected the artificial sequence that has carried out the GHRH of optimization according to the different animals gene order.
CN1635898 protects the porcine growth hormone releasing hormone analog with super-active.
USP 7,351,815 and 7,361,642 all protect the nucleotide sequence and the aminoacid sequence of the growth hormone releasing hormone of dog.
As far back as 1997, Draghia-Akli etc. realized promoting the effect of pig weight increase through intramuscular injection pig GHRH expression plasmid
[3]Follow-up experiment has also further confirmed same result
[4,5,6]Dog
[7], sheep
[8]Also obtained successful experimental result in the body.
Summary of the invention
The purpose of this invention is to provide a kind of Mink Growth Hormone releasing hormone cDNA and application thereof of cloning acquisition.
For achieving the above object; We have designed a pair of primer according to the conserved sequence of other animal GHRH: upstream primer is (shown in SEQ ID No.5): 5 ' ATGCCACTCTGGGTGTTC 3 ', and downstream primer is (shown in SEQ ID No.6): 5 ' TCATCCTTGGGAGTTCC 3 '.Prepare the hypothalamic total RNA of mink then, carry out reverse transcription then, carry out PCR again, the clone has obtained the cDNA of mink GHRH at last.Its complete sequence is shown in SEQ IDNo.4, and wherein the nucleotide sequence of GHRH mature peptide is shown in SEQ ID No.3, and their difference amino acid sequence coded are respectively shown in SEQ ID No.2 and SEQ ID No.1.
CDNA according to mink GHRH mature peptide provided by the invention; Can it be goal gene, adopt carrier for expression of eukaryon, goal gene is inserted in the carrier like pVAX1 commonly used; Be built into carrier for expression of eukaryon; Intramuscular injection is gone in the mink leg muscle, can obtain mink growing and speed up, the tangible result of weight increase.Mink GHRH complete sequence provided by the invention also capable of using with its great expression in conventional expression system, obtains mink GHRH, is used to prepare the active substance of the growth that can promote the economic animal mink.
Description of drawings
Fig. 1 is that the PCR of the recombinant plasmid that the embodiment of the invention makes up identifies figure, wherein 1:DL-2000plus Marker (5kb, 3kb, 2kb, 1kb, 750bp, 500bp, 250bp, 100bp); 2,3: negative clone; 4,5: positive colony.
Fig. 2 cuts evaluation figure for the recombinant plasmid pMD19-GHRHS enzyme that the embodiment of the invention makes up, wherein 1:DL-2000 Marker (2kb, 1kb, 750bp, 500bp, 250bp, 100bp); 2: plasmid pMD19-GHRHS; 3:PCR identifies; 4: negative control; 5:Sph I singly cuts; 6:BamH I singly cuts; 7:Sph I+BamH I is two to be cut.
Fig. 3 cuts evaluation figure for the recombinant plasmid pVAX1-GHRHS enzyme that the embodiment of the invention makes up, wherein 1:DL-2000 Marker (2kb, 1kb, 750bp, 500bp, 250bp, 100bp); 2: plasmid pVAX1-GHRHS; 3:Not I singly cuts; 4:BamH I singly cuts; 5:PCR identifies; 6: negative control; 7:Not I+BamH I is two to be cut.
Embodiment
Below in conjunction with accompanying drawing and embodiment, specific embodiments of the invention describes in further detail.Following examples are used to explain the present invention, but are not used for limiting scope of the present invention.
Embodiment:
Nucleotides sequence with mink GHRH mature peptide is classified goal gene as, is carrier for expression of eukaryon with pVAX1, and goal gene is inserted in the carrier; Be built into carrier for expression of eukaryon; Intramuscular injection is gone in the mink leg muscle, can obtain mink growing and speed up, the tangible result of weight increase.
The vector construction process is following: with PCR method the signal peptide gene sequence of human growth hormone is connected with the mature peptide gene order of Mink Growth Hormone releasing hormone; Be connected to (pMD19-GHRHS) on the T carrier, cut goal gene and the pVAX1 empty carrier on the pMD19-GHRHS carrier with BamH I and EcoR I are two respectively again.Goal gene is cloned in the pVAX1 carrier, after PCR identifies with order-checking (referring to Fig. 1), again pMD19-GHRHS and pVAX1-GHRHS carrier is carried out enzyme and cut evaluation (referring to Fig. 2 and 3).Confirmation has obtained the pVAX1-GHRHS expression vector.With the expression vector behind the purifying only, be injected into the young ermine leg muscle at 30 2-4 monthly ages respectively, when getting skin, weigh with 20 μ g-30 μ g/, as a result experimental group than control group average weight gain up to 300g.
Wherein, the upstream primer that contains the human growth hormone signal peptide: ATGGCTACAGGCTCCCGGAC (shown in SEQ ID No.7); Downstream primer: CTATCAGAGTCGTACCTTTGCT (shown in SEQ ID No.8); PCR reaction conditions: 95 ℃ of 10min, 94 ℃ of 30sec, 53 ℃ of 30sec, 72 ℃ 30sec30 circulation; 72 ℃ of 10min; Enzyme tangent condition: 37 ℃.
The above only is a preferred implementation of the present invention; Should be pointed out that for those skilled in the art, under the prerequisite that does not break away from know-why of the present invention; Can also make some improvement and retouching, these improvement and retouching also should be regarded as protection scope of the present invention.
Reference
1.Gracia-Navarro?F，
JP，Malagon?MM，Sánchez-Hormigo?A，Luque?RM，Hickey?GJ，Peinado?JR，Delgado?E，Martínez-Fuentes?AJ.Research?progress?in?thestimulatory?inputs?regulating?growth?hormone(GH)secretion.Comp?BiochemPhysiol?B?Biochem?Mol?Biol.2002132(1)：141-50.
2.Currie?B.L，Johansson?K.N.，Greibrokk?T.，Folkers?K.，Bowers?C.Y.Identification?and?purification?of?factor?A-GHRH?from?hypothalami?which?releasesgrowth?hormone.Biochem.Biophys.Res.Commun.1974，60(2)：605-9。
3.Draghia-Akli?R，Fiorotto?ML.A?new?plasmid-mediated?approach?tosupplement?somatotropin?production?in?pigs.J?Anim?Sci.200482(13_suppl)：E264-9。
4. Chen Li is silver-colored, Guo Rongfu, Xiang Zhentian, Feng Yu.PGRF gene plasmid applied research during pig produces, pig industry science, 2006 8:14-6.
5. open bravely Zhou Anguo, Wu De, a Zhu Yu ancient type of banner hoisted on a featherdecked mast, Wang Kangning, Yang Feng.The promotes growth and the metabolic regulation effect study of piglet Skelettmuskel injection pGRF gene plasmid, journal of animal science and veterinary medicine, 2,003 34 (2): 147-51.
6. open sharp space, Sun Baozhong, Wang Min plants the capital.The progress of somatotropin releasing factor (GRF) gene plasmid, HEILONGJIANG ANIMAL SCIENCE AND VETERINARY MEDICINE, 2006 9:19-21.
7.Draghia-Akli?R，Cummings?KK，Khan?AS，Brown?PA，Carpenter?RH.Effectsof?plasmid-mediated?growth?hormone?releasing?hormone?supplementation?in?young，healthy?Beagle?dogs.J?Anim?Sci.200381(9)：2301-10.
8.Meng?QY，Chen?ZQ，Yu?ZQ，Xie?QF，Li?N.Increased?body?weight?viainjecting?myogenic?Expression?gowth?hormone-releasing?hormone(GHRH)plasmidDNA?into?sheep.Anim?Biotech.2004?15(2)：175-92.
Claims (8)
1. a Mink Growth Hormone releasing hormone is characterized in that, the aminoacid sequence of its mature peptide is shown in SEQ ID No.1.
2. Mink Growth Hormone releasing hormone as claimed in claim 1 is characterized in that, the complete aminoacid sequence that comprises its precursor peptide is shown in SEQ ID No.2.
3. the cDNA of the mature peptide of the described Mink Growth Hormone releasing hormone of coding claim 1 is characterized in that its nucleotide sequence is shown in SEQ ID No.3.
4. the cDNA of the described Mink Growth Hormone releasing hormone of coding claim 2 is characterized in that its nucleotide sequence is shown in SEQ ID No.4.
5. the expression vector that contains claim 3 or 4 said cDNA.
6. the host of containing the said expression vector of claim 5.
7. claim 3 or the 4 described cDNA application in preparing the active substance that can promote mink growing.
8. contain the active substance of claim 1 or 2 described Mink Growth Hormone releasing hormones, it can promote mink growing.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN 201010286366 CN102399283B (en) | 2010-09-17 | 2010-09-17 | Mink growth hormone releasing hormone cDNA and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN 201010286366 CN102399283B (en) | 2010-09-17 | 2010-09-17 | Mink growth hormone releasing hormone cDNA and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN102399283A true CN102399283A (en) | 2012-04-04 |
| CN102399283B CN102399283B (en) | 2013-05-29 |
Family
ID=45881983
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN 201010286366 Expired - Fee Related CN102399283B (en) | 2010-09-17 | 2010-09-17 | Mink growth hormone releasing hormone cDNA and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN102399283B (en) |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102688503A (en) * | 2012-06-20 | 2012-09-26 | 中国农业大学 | Medical composition for promoting weight gain of fox |
| CN102688504A (en) * | 2012-06-20 | 2012-09-26 | 中国农业大学 | Medicinal composition for promoting weight increment of mink |
| US9096684B2 (en) | 2011-10-18 | 2015-08-04 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US9845287B2 (en) | 2012-11-01 | 2017-12-19 | Aileron Therapeutics, Inc. | Disubstituted amino acids and methods of preparation and use thereof |
| US9957299B2 (en) | 2010-08-13 | 2018-05-01 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10202431B2 (en) | 2007-01-31 | 2019-02-12 | Aileron Therapeutics, Inc. | Stabilized P53 peptides and uses thereof |
| US10213477B2 (en) | 2012-02-15 | 2019-02-26 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10253067B2 (en) | 2015-03-20 | 2019-04-09 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and uses thereof |
| US10301351B2 (en) | 2007-03-28 | 2019-05-28 | President And Fellows Of Harvard College | Stitched polypeptides |
| US10471120B2 (en) | 2014-09-24 | 2019-11-12 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and uses thereof |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102399284A (en) * | 2010-09-17 | 2012-04-04 | 中国农业大学 | Fox growth hormone releasing hormone cDNA and its application |
-
2010
- 2010-09-17 CN CN 201010286366 patent/CN102399283B/en not_active Expired - Fee Related
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102399284A (en) * | 2010-09-17 | 2012-04-04 | 中国农业大学 | Fox growth hormone releasing hormone cDNA and its application |
Non-Patent Citations (3)
| Title |
|---|
| HYUN SUB CHEONG: "Growth hormone-releasing hormone (GHRH) polymorphisms associated with carcass traits of meat in Korean cattle", 《BMC GENETICS》, vol. 7, no. 35, 3 June 2006 (2006-06-03) * |
| M.G. THOMAS: "Dynamics of GHRH in third-ventricle cerebrospinal fluid of cattle: Relationship with serum concentrations of GH and responses to appetite-regulating peptides", 《DOMESTIC ANIMAL ENDOCRINOLOGY》, vol. 37, 31 December 2009 (2009-12-31), pages 196 - 205, XP026675539, DOI: doi:10.1016/j.domaniend.2009.05.006 * |
| 陶 新: "生长激素释放肽在动物科学中的研究进展", 《中国兽药杂志》, vol. 36, no. 12, 31 December 2002 (2002-12-31), pages 40 - 42 * |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10202431B2 (en) | 2007-01-31 | 2019-02-12 | Aileron Therapeutics, Inc. | Stabilized P53 peptides and uses thereof |
| US10301351B2 (en) | 2007-03-28 | 2019-05-28 | President And Fellows Of Harvard College | Stitched polypeptides |
| US9957299B2 (en) | 2010-08-13 | 2018-05-01 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US9096684B2 (en) | 2011-10-18 | 2015-08-04 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US9522947B2 (en) | 2011-10-18 | 2016-12-20 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10308699B2 (en) | 2011-10-18 | 2019-06-04 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| US10213477B2 (en) | 2012-02-15 | 2019-02-26 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles |
| CN102688504A (en) * | 2012-06-20 | 2012-09-26 | 中国农业大学 | Medicinal composition for promoting weight increment of mink |
| CN102688503A (en) * | 2012-06-20 | 2012-09-26 | 中国农业大学 | Medical composition for promoting weight gain of fox |
| US9845287B2 (en) | 2012-11-01 | 2017-12-19 | Aileron Therapeutics, Inc. | Disubstituted amino acids and methods of preparation and use thereof |
| US10669230B2 (en) | 2012-11-01 | 2020-06-02 | Aileron Therapeutics, Inc. | Disubstituted amino acids and methods of preparation and use thereof |
| US10471120B2 (en) | 2014-09-24 | 2019-11-12 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and uses thereof |
| US10253067B2 (en) | 2015-03-20 | 2019-04-09 | Aileron Therapeutics, Inc. | Peptidomimetic macrocycles and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN102399283B (en) | 2013-05-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN102399283B (en) | Mink growth hormone releasing hormone cDNA and application thereof | |
| CN102399284B (en) | Fox growth hormone releasing hormone cDNA and its application | |
| Doyon et al. | Corticotropin-releasing factor and neuropeptide Y mRNA levels are elevated in the preoptic area of socially subordinate rainbow trout | |
| McRORY et al. | Expression and alternative processing of a chicken gene encoding both growth hormone-releasing hormone and pituitary adenylate cyclase-activating polypeptide | |
| Duguay et al. | Nucleotide sequence and tissue distribution of three insulin-like growth factor I prohormones in salmon. | |
| Yoshiura et al. | Duality of gonadotropin in a primitive teleost, Japanese eel (Anguilla japonica) | |
| Chen et al. | Expression of recombinant tilapia insulin-like growth factor-I and stimulation of juvenile tilapia growth by injection of recombinant IGFs polypeptides | |
| Distler et al. | Expression of cyclic nucleotide-gated cation channels in non-sensory tissues and cells | |
| Fradinger et al. | Characterization of the gene encoding both growth hormone-releasing hormone (GRF) and pituitary adenylate cyclase-activating polypeptide (PACAP) in the zebrafish | |
| Moav et al. | Thyroid hormone increases transcription of growth hormone mRNA in rainbow trout pituitary | |
| Nam et al. | Molecular and functional analyses of growth hormone-releasing hormone (GHRH) from olive flounder (Paralichthys olivaceus) | |
| Jeh et al. | Recombinant flounder growth hormone from Escherichia coli: overexpression, efficient recovery, and growth-promoting effect on juvenile flounder by oral administration | |
| Wu et al. | Stimulatory effects of neuropeptide Y on the growth of orange-spotted grouper (Epinephelus coioides) | |
| Wang et al. | Molecular characterization of Kiss2 receptor and in vitro effects of Kiss2 on reproduction-related gene expression in the hypothalamus of half-smooth tongue sole (Cynoglossus semilaevis) | |
| Chatterjee et al. | Molecular cloning of cDNA encoding thyroid stimulating hormone β subunit of bighead carp Aristichthys nobilis and regulation of its gene expression | |
| Zhang et al. | Sex biased expression of ghrelin and GHSR associated with sexual size dimorphism in yellow catfish | |
| Shinoda et al. | Molecular cloning and expression analysis of Fshr and Lhr in relation to Fshb and Lhb subunits during the period of temperature‐dependent sex determination in pejerrey Odontesthes bonariensis | |
| JPH03210187A (en) | Gene expression enhanced in response to milk secretion signal | |
| Gregory et al. | Cloning and sequence analysis of a cDNA for the β subunit of chicken thyroid-stimulating hormone | |
| WO2002061037B1 (en) | Administration of nucleic acid sequence to female animal | |
| CN100435848C (en) | Gene treatment to raise feed efficiency and promote growth of farm animal | |
| Wang et al. | Cloning and characterization of cDNAs encoding the GnRH1 and GnRH2 precursors from bullfrog (Rana catesbeiana) | |
| Nam et al. | Structural and functional characterization of pituitary adenylyl cyclase-activating polypeptide (PACAP)/PACAP-related peptide (PRP) and its receptor in olive flounder (Paralichthys olivaceus) | |
| CN105254766B (en) | Application of the Mecano growth factor MGF E domain peptides in regulation and control memory related gene and miRNA expression | |
| JPH03210181A (en) | Sheep follicle stimulating hormone |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| C14 | Grant of patent or utility model | ||
| GR01 | Patent grant | ||
| C17 | Cessation of patent right | ||
| CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20130529 Termination date: 20130917 |