CA2519750A1 - Implants with functionalized carbon surfaces - Google Patents

Implants with functionalized carbon surfaces Download PDF

Info

Publication number
CA2519750A1
CA2519750A1 CA002519750A CA2519750A CA2519750A1 CA 2519750 A1 CA2519750 A1 CA 2519750A1 CA 002519750 A CA002519750 A CA 002519750A CA 2519750 A CA2519750 A CA 2519750A CA 2519750 A1 CA2519750 A1 CA 2519750A1
Authority
CA
Canada
Prior art keywords
carbon
poly
implant
based layer
implants
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
CA002519750A
Other languages
French (fr)
Inventor
Joerg Rathenow
Soheil Asgari
Andreas Ban
Juergen Kunstmann
Bernhard Mayer
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cinvention AG
Original Assignee
Individual
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from DE2003124415 external-priority patent/DE10324415A1/en
Priority claimed from DE2003133098 external-priority patent/DE10333098A1/en
Priority claimed from DE10333099A external-priority patent/DE10333099A1/en
Application filed by Individual filed Critical Individual
Publication of CA2519750A1 publication Critical patent/CA2519750A1/en
Abandoned legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L27/00Materials for grafts or prostheses or for coating grafts or prostheses
    • A61L27/28Materials for coating prostheses
    • A61L27/30Inorganic materials
    • A61L27/303Carbon
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L27/00Materials for grafts or prostheses or for coating grafts or prostheses
    • A61L27/50Materials characterised by their function or physical properties, e.g. injectable or lubricating compositions, shape-memory materials, surface modified materials
    • A61L27/56Porous materials, e.g. foams or sponges
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L27/00Materials for grafts or prostheses or for coating grafts or prostheses
    • A61L27/28Materials for coating prostheses
    • A61L27/30Inorganic materials
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L31/00Materials for other surgical articles, e.g. stents, stent-grafts, shunts, surgical drapes, guide wires, materials for adhesion prevention, occluding devices, surgical gloves, tissue fixation devices
    • A61L31/08Materials for coatings
    • A61L31/082Inorganic materials
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L31/00Materials for other surgical articles, e.g. stents, stent-grafts, shunts, surgical drapes, guide wires, materials for adhesion prevention, occluding devices, surgical gloves, tissue fixation devices
    • A61L31/08Materials for coatings
    • A61L31/082Inorganic materials
    • A61L31/084Carbon; Graphite
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L31/00Materials for other surgical articles, e.g. stents, stent-grafts, shunts, surgical drapes, guide wires, materials for adhesion prevention, occluding devices, surgical gloves, tissue fixation devices
    • A61L31/08Materials for coatings
    • A61L31/10Macromolecular materials
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L31/00Materials for other surgical articles, e.g. stents, stent-grafts, shunts, surgical drapes, guide wires, materials for adhesion prevention, occluding devices, surgical gloves, tissue fixation devices
    • A61L31/14Materials characterised by their function or physical properties, e.g. injectable or lubricating compositions, shape-memory materials, surface modified materials
    • A61L31/146Porous materials, e.g. foams or sponges
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L31/00Materials for other surgical articles, e.g. stents, stent-grafts, shunts, surgical drapes, guide wires, materials for adhesion prevention, occluding devices, surgical gloves, tissue fixation devices
    • A61L31/14Materials characterised by their function or physical properties, e.g. injectable or lubricating compositions, shape-memory materials, surface modified materials
    • A61L31/16Biologically active materials, e.g. therapeutic substances
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2300/00Biologically active materials used in bandages, wound dressings, absorbent pads or medical devices
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61LMETHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
    • A61L2400/00Materials characterised by their function or physical properties
    • A61L2400/18Modification of implant surfaces in order to improve biocompatibility, cell growth, fixation of biomolecules, e.g. plasma treatment

Abstract

The invention relates to a method for producing medical implants comprising functionalized surfaces by providing at least part of the surface of a medical implant with at least one carbon-containing layer, activating the carbon-containing layer by creating porosity, and functionalizing the activated, carbon-containing layer. Also disclosed are functionalized implants that are obtained by means of the inventive method.

Description

IMPLANTS WITH FUNCTIONALIZED CARBON SURFACES
The present invention relates to a method for producing medical implants having functionalized surfaces by providing a medical implant with at least one carbon-based layer on at least a portion of the surface of the implant, activating the carbon-based layer by creating porosity and functionalizing the activated carbon-based layer;
this invention also relates to functionalized implants obtainable by this method.
Medical implants such as surgical and/or orthopedic screws, plates, joint prostheses, artificial heart valves, vascular prostheses, stems as well as subcutaneously or intramuscularly implantable active agent depots are produced from a wide variety of materials, which are selected according to specific biochemical and mechanical properties. These materials must have certain mechanical and biochemical properties, must not release any toxic substances and must be suitable for long-term use in the body.
However, the metals or metal alloys and ceramic materials frequently used for stems and joint prostheses, for example, often have disadvantages with regard to their biocompatibility or functionality, in particular in long-term use. Implants trigger inflammatory tissue responses and immune reactions through chemical and/or physical irntation, thus resulting in intolerance reactions in the sense of chronic inflammatory reactions with defensive and rejection reactions, excessive scar tissue production or degradation of tissue, which in the extreme case must result in the implant having to be removed and replaced or additional therapeutic interventions of an invasive or noninvasive type being indicated.
For this reason, there are various approaches in the state of the art for coating surfaces of medical implants in a suitable way to increase the biocompatibility of the materials used or the functional efficacy of the implants and to prevent defensive reactions, i.e., rejection.
United States Patent 5,891,507, for example, discloses methods for coating the surface of metal stems with silicone, polytetrafluoroethylene and biological materials such as heparin or growth factors which increase the biocompatibility of the metal stems.
In addition to plastic layers, carbon-based layers have proven to be particularly advantageous.
For example, German Patent DE 199 51 477 describes coronary stems with a coating of amorphous silicon carbide, which increases the biocompatibility of the stmt material.
United States Patent 6,569,107 describes carbon-coated stems in which the carbon material is applied by chemical or physical vapor-phase deposition methods (CVD or PVD). United States Patent 5,163,958 also describes tubular endoprostheses or stems with a coated surface having antithrombogenic properties. WO 02/09791 describes intravascular stems with coatings produced by CVD of siloxanes.
In addition to the CVD methods for deposition of carbon, various high-vacuum sputtering methods have been described in the state of the art for production of pyrolytic carbon layers with various structures (see United States Patent 6,355,350, for example).
The implants with modified surfaces produced in this way still have some disadvantages, however. The biocompatibility is not adequate in all cases to completely prevent rejection reactions. Furthermore, the surface-coated implants of the state of the art usually have closed pores, which make intergrowth with the surrounding body tissue difficult or impossible and/or restrict functionalization. Although the prior art implants can also be coated with antibiotics, the effect of the substances after implanting the implant is always short lasting, however, because the quantities of active ingredient applied are limited by the nature of the implant and by its surface coating or its desorption cannot be controlled or its efficacy is impaired by physical or chemical interactions with the coating.
Furthermore, it is appropriate and advisable from a medical standpoint if implants can be used not only in their supporting function, as is the case with stems, but can also be provided with additional functions, e.g., long-term delivery of medications at the site of implantation of the implant to potentiate the effect of the implant or to achieve additional medically desirable effects.
There has therefore been a demand for inexpensive, easy-to-use methods for producing functionalized implants.
Furthermore, there has also been a demand for medical implants that are inexpensive to manufacture and have improved properties.
One object of the present invention is therefore to make available a method for producing implants with an additional functionality.
Another object of the present invention is to make available medical implants which can assume additional functions, such as the release of pharmaceutical substances in the body or the growth of tissue, and thereby have increased biocompatibility and/or have a stronger functional implant effect.
Another object of the present invention is to make available medical implants which permit a long-term release of medical active ingredients in the body of the patient or which have a function that is improved by surface modification.
Yet another function of the present invention is make available medical implants which can release pharmacologically active substances that are applied to or incorporated into the implant in a controlled manner after implantation of the implant in the human body.
Another object of this invention is to provide implantable active ingredient depots with a coating which is capable of controlling the release of active ingredients from the depot.
Another object of this invention is to make available medical implants which contain applied and/or incorporated microorganisms, viral vectors or cells or tissue, so that after the implant has been implanted in the human body, a therapeutic effect can be achieved in a control manner or the bioavailability can be increased.
The inventive solution to the objects indicated above consists of a method and medical implants obtainable by this method as defined in the independent claims.
Preferred embodiments of the inventive method and/or the inventive products and uses are derived from the dependent subordinate claims.
Within the context of the present invention, it has been discovered that carbon-based layers in particular on implantable medical devices of a wide variety of types can be utilized easily to equip the implant with additional medical physiological and therapeutic functions.
It is possible in particular according to this invention to apply therapeutically active quantities of pharmaceutical agents to the surface of an implant or in a layer present on the implant and to release these substances continuously in a controlled manner in the human body.
Accordingly, the inventive method for producing medical implants having functionalized surfaces comprises the following steps:
a) providing a medical implant with at least one carbon-based layer on at least a portion of the surface of the implant;
b) activating the carbon-based layer by creating porosity;
c) functionalizing the activated carbon-based layer.
With the inventive method, it is possible to suitably modify implants having carbon-based surface coatings to make it possible to load them with therapeutically active amounts of active pharmacologic substances. By creating porosity in carbon-based surface layers of a suitable thickness, controlled adjustment/modification of the pore size and/or pore structure and optionally a suitable surface coating that modifies release, it is possible to adjust and vary in a controlled manner the load quantity, type and rate of release as well as the biological physiological surface properties. This also makes it possible to implement embodiments tailored to each specific type of implant and active ingredient as well as each site of application and intended use of medical implants with simple procedural measures such as those described according to this invention.
IMPLANTS
Implants coated with a carbon-based coating can be functionalized by the method according to this invention.
The terms "implantable medical device" and "implant" are used synonymously here and are understood to include medical or therapeutic implants, such as vascular endoprostheses, intraluminal endoprostheses, stems, coronary stems, peripheral stems, surgical and/or orthopedic implants for temporary use, such as surgical screws, plates, nails and other fastening means, permanent surgical or orthopedic implants, such as bone prostheses or joint prostheses, e.g., artificial hip or knee joints, socket joint inserts, screws, plates, nails, implantable orthopedic fixation aids, vertebral prostheses and artificial hearts and parts thereof as well as artificial heart valves, heart pacemaker casings, electrodes, subcutaneous and/or intramuscularly implantable implants, active ingredient depots and microchips and the like.
The implants that can be used in the inventive method may consist of almost any materials, preferably those that essentially have thermal stability, in particular all materials of which such implants are typically produced.
Examples include amorphous and/or (partially) crystalline carbon, solid carbon material, porous carbon, graphite, carbon composite materials, carbon fibers, ceramics such as zeolites, silicates, aluminum oxides, aluminosilicates, silicon carbide, silicon nitride, metal carbides, metal oxides, metal nitrides, metal carbonitrides, metal oxycarbides, metal oxynitrides and metal oxycarbonitrides of the transition metals, such as titanium, zirconium, hafnium, vanadium, niobium, tantalum, chromium, molybdenum, tungsten, manganese, rhenium, iron, cobalt, nickel; metals and metal alloys, in particular the noble metals such as gold, silver, ruthenium, rhodium, palladium, osmium, iridium, platinum; metals and metal alloys of titanium, zirconium, hafnium, vanadium, niobium, tantalum, chromium, molybdenum, tungsten, manganese, rhenium, iron, cobalt, nickel, copper; steel, in particular stainless steel, memory alloys such as nitinol, nickel titanium alloy, glass, stone, glass fibers, minerals, natural or synthetic bone substance, imitation bone based on alkaline earth metal carbonates such as calcium carbonate, magnesium carbonate, strontium carbonate, foamed materials such as polymer foams, foamed ceramics and the like as well as any combinations of the aforementioned materials.
In preferred embodiments of the present invention, the implants used are stems, in particular metal stems, preferably made of stainless steel, platinum-based radiopaque steel alloys, so-called PERSS (platinum-enhanced radiopaque stainless steel alloys), cobalt alloys, titanium alloys, high-melting alloys, e.g., based on niobium, tantalum, tungsten and molybdenum, noble metal alloys, nitinol alloys as well as magnesium alloys and mixtures of the above.
Especially preferred implants within the scope of the present invention include stems made of stainless steel, in particular Fe-l8Cr-l4Ni-2.5Mo ("316LVM" ASTM F
138), Fe-2lCr-lONi-3.5Mn-2.5Mo (ASTM F 1586), Fe-22Cr-l3Ni-5Mn (ASTM F 1314), Fe-23Mn-2lCr-1Mo-1N (nickel-free stainless steel); stems made of cobalt alloys such as Co-20Cr-15W-IONi ("L605" ASTM F 90), Co-20Cr-35Ni-IOMo ("MP35N" ASTM
F 562), Co-20Cr-l6Ni-l6Fe-7Mo ("Phynox" ASTM F 1058). Examples of preferred titanium alloys include CP titanium (ASTM F 67, Grade 1), Ti-6A1-4V
(alpha/beta ASTM F 136), Ti-6A1-7Nb (alpha/beta ASTM F1295), Ti-lSMo (beta grade ASTM
F 2066); stems made of noble metal alloys in particular alloys containing iridium such as Pt-lOIr; nitinol alloys such as martensitic, superelastic and cold-workable (preferably 40%) nitinols and magnesium alloys such as Mg-3A1-1Z.
The implantable medical devices that can be used according to this invention may have almost any external form. The inventive method is not limited to certain structures.
The implants must have a carbon-based layer on at least a portion of their surface. This layer may consist of pyrolytically produced carbon, vitreous amorphous carbon, vapor-deposited carbon, carbon applied by CVD, PVD or sputtering, diamond-like, graphitic carbon, metal carbides, metal carbonitrides, metal oxynitrides or metal oxycarbides as well as any combinations thereof. The carbon-based layer may be amorphous, partially crystalline or crystalline, preferably consisting of layers of amorphous pyrolytic carbon, and in some embodiments it may also be diamond-like, e.g., vapor-deposited carbon.
Implants with a carbon-based coating produced by applying material that produce carbon and/or polymer films to the implant and then carbonizing these materials in the absence of oxygen at elevated temperatures are especially preferred. Examples are disclosed in German Patent DE 10322187 and/or PCT/EP2004/005277, German Patent DE 10324415 and/or PCT/EP2004/004987 and German Patent DE 10333098 and/or PCT/EP2004/004985, the disclosures of which are herewith fully incorporated by reference.
Other suitable implants with a carbon-based coating include commercial carbon-coated implants such as metal stems of the Radix Carbostent~ type (Sorin Biomedica) and the like, most of which have carbon coatings produced by physical vapor deposition or atomization methods, including sputtering.
The thickness of one or more carbon-based layers may in general be from 1 nm to 1 mm, optionally even several millimeters, e.g., up to 10 mm, preferably up to 6 mm, especially preferably up to 2 mm, in particular between 10 nm and 200 pm.
In preferred embodiments of the present invention, the implantable medical devices may also have multiple carbon-based layers of the same or different thickness and/or porosity. For example, it is possible to combine deeper more porous layers with narrow-pored layers above them which can suitably delay the release of the active ingredients deposited in the more porous layer.

_ 7 _ ACTIVATION
According to the inventive method, the physical and chemical properties of the carbon-based coating are further modified by suitable activation steps and adapted to the intended purpose. Traditional carbon-based implants usually have essentially closed surfaces, which greatly restrict effective and long-lasting loading with active ingredients, for example, or limit it to a very small amount. The purpose of activation is to create porosity in the carbon-based layer and/or to form a porous carbon-based layer on the implant in order to thereby permit better functionalization by means of active ingredients, cells, proteins, microorganisms, etc., and to increase the ability to uptake the carbon-based layer per unit of area.
The activation step in the inventive method thus consists essentially of creating porosity in the carbon layer on the implant. Several possibilities are available here.
One possible method of activating the carbon layer includes, for example, reductive or oxidative treatment steps in which the layer is treated one or more times with suitable reducing agents and/or oxidizing agents, such as hydrogen, carbon dioxide, water vapor, oxygen, air, nitrous oxide or oxidizing acids such as nitric acid and the like and optionally mixtures of these.
Activation with air is preferred, especially preferably at an elevated temperature.
The activation steps) may be carned out at an elevated temperature, e.g., from 40°C to 1000°C, preferably 70°C to 900°C, especially preferably from 100°C to 850°C, in particular preferably from 200°C to 800°C and most especially at approximately 700°C.
In especially preferred embodiments, the carbon-based layer is modified by reduction or oxidation or a combination of these treatment steps at room temperature.
Boiling in oxidizing acids or bases may also be used to produce a porous surface.
The pore size and pore structure can be varied according to the type of oxidizing agent or reducing agent used, the temperature and the duration of the activation. In particularly preferred embodiments, carbon-based medical implants activated according to this invention can be used for controlled release of active ingredients from the substrate into the environment through targeted adjustment of the porosity of the carbon layer.

The coatings are preferably porous after activation, in particular having a nanoporosity.
Medical implants can be used as a drug vehicle with a depot effect according to this invention, for example, in particular when the implant itself also has a porous structure, in which the activated carbon-based layer of the implant can be used as a membrane which regulates the rate of release.
In preferred embodiments, the porosity can be adjusted by washing out fillers that are present in the carbon-based coating, e.g., polyvinylpyrrolidone, polyethylene glycol, powdered aluminum, fatty acids, microwaxes or emulsions, paraffins, carbonates, dissolved gases or water-soluble salts with water, solvents, acids or bases or by distillation or oxidative and/or non-oxidative thermal decomposition. Suitable methods of this are described in German Patent DE 103 22 187 and/or PCT/EP2004/005277, for example, by the present applicant, the disclosures of which are herewith fully incorporated by reference.
The porosity may optionally also be created by structuring the surface with powdered substances such as metal powder, carbon black, phenolic resin powder, fibers, in particular carbon fibers or natural fibers.
Another possibility for activation and/or producing porosity is by sputtering the carbon-based layer with suitable elements or so-called ion bombardment, e.g., with noble gas ions or the like.
The activated coating may optionally also be subjected to a so-called CVD
process (chemical vapor deposition) or CVI process (chemical vapor infiltration) in another optional process step in order to further modify the surface structure or pore structure and its properties. To do so, the carbonized coating is treated with suitable precursor gases that release carbon at high temperatures. Subsequent application of diamond-like carbon is preferred here. Other elements may also be deposited in this way, such as silicon. Such methods are known in the state of the art.
Almost all known saturated and unsaturated hydrocarbons with sufficient volatility under CVD conditions may be used as the precursors to split off carbon.
Examples include methane, ethane, ethylene, acetylene, linear and branched alkanes, alkenes and alkynes with carbon numbers of C1 to CZO, aromatic hydrocarbons such as benzene, naphthalene, etc., and aromatics with one or more alkyl, alkenyl and alkynyl substituents, such as toluene, xylene, cresol, styrene, etc.

_ g _ Suitable ceramic precursors include, for example, BC13, NH3, silanes such as SiH4, tetraethoxysilane (TEOS), dichlorodimethylsilane (DDS), methyltrichlorosilane (MTS), trichlorosilyldichloroborane (TDADB), hexadichloromethylsilyloxide (HDMSO), A1C13, TiCl3 or mixtures thereof.
In the CVD method, the precursors are mostly used in a low concentration of approximately 0.5 to 15 vol% in mixture with an inert gas such as nitrogen, argon or the like. Hydrogen may also be added to the corresponding gas mixtures for deposition. At temperatures between 500°C and 2000°C, preferably 500°C
to 1 S00°C and especially preferably 700°C to 1300°C, the compounds mentioned above split off hydrocarbon fragments and/or carbon or ceramic precursors, which are deposited in an essentially uniform distribution in the pore system of the pyrolyzed coating, where they modify the pore structure and produce an essentially homogeneous pore size and pore distribution.
By means of CVD methods, the size of pores in the carbon-based layer on the implant can be reduced in a controlled manner or the pores may even be completely closed and/or sealed. This makes it possible to adjust the sorptive properties as well as the mechanical properties of the activated implant surface in a tailored manner.
By CVD of silanes or siloxanes, optionally in mixture with hydrocarbons, the carbon-based implant coatings can be modified by formation of carbide or oxycarbide, so that they are resistant to oxidation, for example.
In preferred embodiments, the coated implants activated according to this invention can be additionally coated andlor modified by sputtering methods. Carbon, silicon and metals and/or metal compounds can be applied by essentially known methods from suitable sputter targets. For example, by incorporating silicon compounds, titanium compounds, zirconium compounds, or tantalum compounds or metals by CVD or PVD
into the carbon-based layer, it is possible to form carbide phases which increase the stability and oxidation resistance of the layer.
In another preferably embodiment of the activation step, carbon-based layers, even sputtered carbon layers, for example, can be worked mechanically afterwards to produce porous surfaces. For example, controlled abrasion of these layers by suitable methods leads to porous layers. A preferred option is abrasion of such carbon-based layers in an ultrasonic bath, where defects in the layers and thus porosity can be produced in a targeted manner by admixture of abrasive solids of various particle sizes and degrees of hardness by appropriate input of energy and a suitable frequency of the ultrasonic bath as a function of treatment time.
Aqueous ultrasonic baths to which alumina, silicates, aluminates and the like have been added, preferably alumina dispersions, are preferred here. However, any other solvents that are suitable for ultrasonic baths may also be used instead of or in combination with water.
For example, by treatment of carbon-coated implants in an aqueous ultrasonic bath with the admixture of alumina, preferably 1 % to 60% alumina dispersions, it is possible to produce nano-abraded carbon layers with an average pore size of approximately 5 nm to 200 nm.
Furthermore, by ion implantation of metals, in particular transition metals and/or non-metals, the surface properties of the implant can be further modified. For example, by nitrogen implantation it is possible to incorporate nitrides, oxynitrides or carbonitrides, in particular those of the transition metals. The porosity and strength of the surface materials can be further modified by implantation of carbon.
The carbon-based layer is preferably porous after activation, with pore diameters in the range of 0.1 ~.m to 1000 Vim, preferably between 1 ~m and 400 Vim. Macroporous layers can also be produced with the inventive activation steps.
The carbon-based layer is especially preferably nanoporous after activation with pore diameters of 1 nm to 1000 nm, preferably from 5 nm to 900 nm.
In an especially preferred embodiment of this invention, the activation is performed during the step of production of the carbon-based layer, e.g., by applying one or more porous carbon-based layers, by carbonization of substances that produce carbon, by coating with carbon by CVD or PVD and/or by applying suitable layers of porous biodegradable and/or resorbable or non-biodegradable and/or resorbable polymers.
It is especially preferable for one or more porous carbon-based layers to be applied by coating the implant with an optionally foamed polymer film or one containing fillers and then carbonizing the polymer film at temperature of 200°C to 3500°C, preferably up to 2000°C in an oxygen-free atmosphere, optionally partially oxidized in an air stream subsequently. Corresponding methods are described, for example, in German Patent DE 10324415 and/or PCT/EP2004/004987 and in German Patent DE 10333098 and/or PCT/EP2004/004985, the disclosures of which are herewith fully incorporated by reference.
Thus, for example, adding polyethylene glycol to the polymer film that is to be carbonized produces defects in the polymer crosslinking which in turn produce a porous carbon layer after thermal treatment or dissolving in suitable solvents.
Porosity suitable for a given application can be achieved through the choice of the polymer system, the molecular weight of polyethylene glycol and the polyethylene glycol solids content, and in particular the average porosity, the pore size distribution and the degree of porosity can be adjusted. For example, by selecting polyethylene glycols with a molecular weight of 1000 to 8,000,000 Dalton, it is possible to produce pore sizes from 10 nm to 1000 nm or in a preferred embodiment from 50 nm to 1000 nm. By varying the solids content from 10% to 80%, a degree of porosity from 5% to 80% can be produced, preferably 20% to 60%.
Another example of this type of combined production and activation of the carbon-based layer is by admixture of carbon black to the polymer film. Through the choice of the average particle size and the solids content in the polymer film, it is possible to produce porous matrices in which the degree of porosity and average pore size can be adjusted through the choice of suitable polymer systems, carbon black particle sizes and the solids content, depending on the application. Thus, for example, by admixture of carbon black particles with an average particle size of 10 nm to 1 mm, preferably 10 nm to 1000 nm, with a solids content of 20% to 80%, preferably 30% to 60%, an average porosity of 30% to 60% can be produced, with the pore sizes produced being adjustable between 10 nm and 1000 nm, preferably from 10 nm to 800 nm.
Furthermore, by optional parylenation of the implants before or after the activation steps, the surface properties and porosity of the carbon-based layer can be further modified. The implants here are first treated with paracyclophane at an elevated temperature, usually approximately 600°C, with a polymer film of polyp-xylylene) being formed on the surface of the implants. This film can then be converted to carbon by known methods in a subsequent carbonization step.
If necessary, in particularly preferred embodiments, the activated implant may be subjected to additional chemical and/or physical surface modifications.
Cleaning steps to remove any residues and impurities that might be present may also be provided here.
For this purpose, acids, in particular oxidizing acids, or solvents may be used, but boiling in acids or solvents is preferred. Carboxylation of these activated carbon layers can be achieved by boiling in oxidizing acids.
Before medical use or loading with active ingredients, the inventive implants may be sterilized by conventional methods, e.g., by autoclaving, ethylene oxide sterilization or gamma-radiation.
According to this invention, all possible activation methods may be combined or used with any of the functionalization steps described below.
FUNCTIONALIZATION
The implants may be additionally equipped with a number of functions by suitable measures. Orthopedic and surgical implants or vascular endoprostheses may be used as drug vehicles or depots. The biocompatibility and functionality of the inventive implants can be influenced or altered in a controlled manner by incorporating additives, fillers, proteins, etc. This makes it possible to reduce or entirely prevent rejection reactions in the body when using implants produced according to this invention or the efficacy of the implant may be increased and/or additional effects achieved.
Functionalization in the sense of the present invention is understood to refer in general to measures as a consequence of which the carbon-based layer gains additional functions. Functionalization according to this invention consists of incorporating substances into the carbon-based layer or attaching substances to the carbon-based layer. Suitable substances are selected from pharmacological active ingredients, linkers, microorganisms, cells of plant or animal origin including human cells or cell cultures and tissue, minerals, salts, metals, synthetic or natural polymers, proteins, peptides, amino acids, solvents, etc.
According to this invention, the suitably activated implant can be functionalized by making it more biocompatible before or after a possible loading with active ingredients.
This is done by coating it with at least one additional layer of biodegradable and/or absorbable polymers such as collagen, albumin, gelatin, hyaluronic acid, starch, celluloses such as methyl cellulose hydroxypropylmethyl cellulose, carboxymethyl cellulose phthalate; casein, dextrans, polysaccharides, fibrinogen, poly(D,L-lactides), poly(D,L-lactide-co-glycolides), poly(glycolides), poly(hydroxybutylates), poly(alkyl carbonates), poly(orthoesters), polyesters, poly(hydroxyvaleric acid), polydioxanones, polyethylene terephtalate), poly(malic acid), poly(tartronic acid), polyanhydrides, polyphosphazenes, poly(amino acids) and their copolymers or non-biodegradable and/or absorbable polymers. In particular anionic, cationic or amphoteric coatings are especially preferred, such as alginate, carrageenan, carboxymethyl cellulose, chitosan, poly-L-lysine and/or phosphorylcholine.
In the functionalization step of the inventive method, active ingredients such as pharmaceutical drugs and medications may be applied to the activated carbon-based layer or incorporated into the layer. This is useful in particular in cases where active ingredients cannot be applied in or to the implant directly as in the case of metals, for example.
For example, sparingly water-soluble lipophilic active ingredients such as paclitaxel are difficult to apply to metallic surfaces because they tend to form a crystalline film.
Usually the immobilizable quantities are limited and the release cannot be controlled.
Direct coating of such metallic surfaces with paclitaxel leads to maximum loading of approximately 3 mg/mm2, the release of which under physiological conditions in physiological buffer solutions leads to uncontrolled desorption of max. 30%
with in one to five days.
Carbon layers activated according to this invention, preferably vitreous amorphous carbon with a layer thickness in the range of 80 nm to 10 ~.m, preferably 100 nm to Vim, preferably with a pore size of 5 nm to 100 pm, preferably from 5 nm to 1000 nm can take up active ingredient quantities amounting to up to 100 times that of non-activated carbon-coated or purely metallic implants e.g., even at porosities of 5 to 50%, preferably 10 to 50% and an average pore size of 5 nm to 1 pm, preferably from 5 nm to 500 nm, and can optionally release these active ingredients in a controlled manner as a function of the porosity and/or pore size and/or surface properties.
In an inventive embodiment with a pore size of SO nm and a porosity of 5%, for example, and with a load of 0.5 to 3.0 pg/mm2 paclitaxel and hydrophobic carbon surfaces with a layer thickness of 200 nm, 70% to 100% of the applied dosage of paclitaxel can be released in a controlled manner at a constant daily release rate under physiological conditions within 25 to 35 days.

In particularly preferred embodiments, through suitable functionalization of any carbon-based layer, peptides and proteins as well as glycoproteins and lipoproteins can also be immobilized.
An inventive form of functionalization consists of covalent or non-covalent adsorption of substances which allow the binding of peptides, proteins, glycoproteins or lipoproteins labeled or otherwise provided with affinity tags.
Such substances include, for example, ions, cations, in particular metal cations such as cobalt, nickel, copper and zinc cations, antibodies, calmodulin, chitin, cellulose, sugars, amino acids, glutathione, streptavidin, Strep-Tactin or other mutants for binding Strep-tag- or SBP-tag-labeled substances or S protein for binding S-tag-labeled substances, etc.
These affinity tags are attached by a suitable method to the peptides, proteins, glycoproteins or lipoproteins to be immobilized, attaching the either the C
terminus or N
terminus of the primary sequence, usually by the methods of recombinant genetic engineering or biotinylation. Affinity tags, in particular polyarginine tags (Arg tag) are preferred, the latter preferably consisting of five to six argininic acids, polyhistidine tags (His tags), a polyhistidine sequence of any desired length, typically two to ten radicals, FLAG tags with the sequence DYKDDDDK, Strep tags, e.g., the Strep tag II
sequence WSHPQFEK, S tags which carry the amino acid radicals KETAAAKFERQHMDS, calmodulin-binding peptide, the family of cellulose-binding domains, in particular C-terminal, N-terminal or other positions in the primary sequence of the peptide, protein, glycoprotein or lipoprotein to be immobilized, the SBP tag with the sequence MDEKTTGWRGGHWEGLAGELEQLRARLEHHPQGQREP, the polyhistidine tag, chitin-binding domains, glutathione S-transferase tag, maltose-binding protein, bacteriophage T7 and VS epitope, but also any other type of affinity tag.
The modification of the substances to be applied to the functionalized carbon surfaces corresponds to the usual methods that are possible in purification and in particular chromatographic labeling.
Functionalization of the carbon surface is accomplished here by adsorption of corresponding substances in and/or on the carbon-based layer such that these substances can enter into a bond with the affinity tags. Corresponding substances include, for example, cations which are introduced into the carbon layer to permit binding to the basic polyarginine tag, e.g., cobalt, nickel, copper and zinc canons to permit binding of polyhistidine tags, for example.
Adsorption of the antibody M1 on the carbon surfaces permits the binding of FLAG
tags, streptavidin or Strep-Tactin or SBP tag-labeled substances or adsorption of the S
protein on the surface to bind S tag labeled substances.
In another embodiment, the funcnonalization consists of using calmodulin which is to be adsorbed on the carbon surface. This makes it possible to bind calmodulin-binding peptide-labeled substances to the carbon-based layer.
In other embodiments, the functionalization is accomplished by adsorption of cellulose, so that substance modified with cellulose binding domains can be bound or it is accomplished by adsorption of chitin to bind substances provided with chitin-binding domains.
Similarly, funcnonalization may be performed with glutathione for binding glutathione S-transferase tag-labeled substances, or with maltose or amylose to bind maltose binding protein labeled substances.
Those skilled in the art will select a suitable affinity system in accordance with the conditions that are possible in genetic engineering, the functional and structural properties of the peptide, protein, glycoprotein or lipoprotein.
For example, carbon layers functionalized with 0.1-8 ~,g/mm2 adsorbed Strep-Tactin can be obtained from a Strep-Tactin solution on porous carbon surfaces with a pore size of 100 to 900 nm, a porosity of 30% to 60% and a layer thickness of 1 to 5 pm by spraying or dipping carbon layers. The carbon layer functionalized in this way can take up, for example, 0.1 to 10 ~g/mmz Strep-tag-labeled recombinant IL-2.
In another embodiment, the carbon layer is doped with cobalt ions, where the porous carbon matrix has a cobalt ion content of 0.1 to 50% of the solids content, preferably up to 60% in vitreous porous carbon layers. At a porosity of 50%, layer thickness of 500 mn to 1000 nm, 0.1 to 100 p,g polyarginine tag-labeled recombinant IL-2 can be adsorbed by the metal ion doping in the matrix.

Another embodiment involves, for example, functionalization of the carbon surfaces by adsorption of linker substances, preferably carboxymethylated dextrans, e.g., as a hydrogel, which permits physical binding of substances, preferably biomolecules or active ingredients and/or have a chemical reactivity so that such substances can be attached by covalent bonds, preferably by forming amino, thiol or aldehyde bonds.
Those skilled in the art will select a suitable type of linker as a function of the type of ligand.
For the production of an amino bond, the carbon layer can be functionalized as follows in a preferred embodiments: adsorption of carboxymethylated dextran, subsequent modification by modification in NHSBDC to convert the carboxymethyl groups into hydroxysuccinimide esters.
This makes it possible to adsorb ligands which enter into covalent amino bonds with the esters. Unreacted esters can be inactivated again in another step, e.g., by incubation in 1M ethanolamine hydrochloride solution. For example, adsorption of 1 ~g carboxyrnethylated dextran per mmz of a porous carbon-based composite layer of vitreous carbon and carbon black particles yields a functionalization which can bind 0.01 to 5000 ~g/mm2 peptides with a molecular weight of 60 to 90 by covalent bonding.
Furthermore, the porous layers activated according to this invention can be loaded with pharmaceutical drugs, i.e., medications, microorganisms, cells and/or tissues in the functionalization step of the process or they may be provided with diagnostic aids such as markers or contract media for localizing coated implants in the body, e.g., even with therapeutic or diagnostic quantities of radioactive substances.
ACTIVE INGREDIENT COATING
In preferred embodiments, the implants activated according to this invention are loaded with active ingredients in the functionalization step. Active ingredients may be loaded into or onto the carbon-based layer by suitable sorptive methods such as adsorption, absorption, physisorption or chemisorption; in the simplest case, they may be loaded by impregnation of the carbon-based coating with active ingredient solutions, active ingredient dispersions or active ingredient suspensions in suitable solvents.
Covalent or non-covalent bonding of active ingredients in or on the carbon-based coating here may be a preferred option, depending on the active ingredient used and its chemical properties.
In preferred embodiments, the active ingredient is applied in the form of a solution, dispersion or suspension in a suitable solvent or solvent mixture, optionally with subsequent drying. Suitable solvents include for example methanol, ethanol, n-propanol, isopropanol, butoxydiglycol, butoxyethanol, butoxyisopropanol, butoxypropanol, n-butyl alcohol, t-butyl alcohol, butylene glycol, butyloctanol, diethylene glycol, dimethoxydiglycol, dimethyl ether, dipropylene glycol, ethoxydiglycol, ethoxyethanol, ethylhexanediol, glycol, hexanediol, 1,2,6-hexanetriol, hexyl alcohol, hexylene glycol, isobutoxypropanol, isopentyldiol, 3-methoxybutanol, methoxydiglycol, methoxyethanol, methoxyisopropanol, methoxymethylbutanol, methoxy PEG-10, methylal, methyl hexyl ether, methylpropanediol, neopentyl glycol, PEG-4, PEG-6, PEG-7, PEG-8, PEG-9, PEG-6-methyl ether, pentylene glycol, PPG-7, PPG-2-buteth-3, PPG-2 butyl ether, PPG-3 butyl ether, PPG-2 methyl ether, PPG-3 methyl ether, propyl ether, propanediol, propylene glycol, propylene glycol butyl ether, propylene glycol propyl ether, tetrahydrofuran, trimethylhexanol, phenol, benzene, toluene, xylene; as well as water, optionally in mixture with dispersion aids and also mixtures of the aforementioned substances.
Preferred solvents include one or more organic solvents from the group consisting of ethanol, isopropanol, n-propanol, dipropylene glycol methyl ether and butoxyisopropanol (1,2-propylene glycol n-butyl ether), tetrahydrofuran, phenol, benzene, toluene, xylene, preferably ethanol, isopropanol, n-propanol and/or dipropylene glycol methyl ether, in particular isopropanol and/or n-propanol.
Active ingredients with suitable dimensions may also be occluded in pores in the activated porous carbon-based coatings.
The loading with the active ingredient may be temporary, i.e., the active ingredient may be released after implantation of the medical device or the active ingredient may be permanently immobilized in or on the carbon-based layer. In this way it is possible to produce medical implants containing active ingredients with static, dynamic or a combination of static and dynamic active ingredient loads. This yields multifunctional coatings based on the carbon-based layers produced according to this invention.

In static loading with active ingredients, the active ingredients are essentially immobilized permanently in or on the coating. Active ingredients used for this purpose include inorganic substances, e.g., hydroxyl apatite (HAP), fluorapatite, tricalcium phosphate (TCP), zinc and/or organic substances such as peptides, proteins, carbohydrates such as monosaccharides, oligosaccharides and polysaccharides, lipids, phospholipids, steroids, lipoproteins, glycoproteins, glycolipids, proteoglycans, DNA, RNA, signal peptides or antibodies and/or antibody fragments, bioabsorbable polymers, e.g., polylactic acid, chitosan as well as pharmacologically active substances or substance mixtures, combinations thereof and the like.
In the case of dynamic active ingredient loading, it is provided that the applied active ingredients will be released after implantation of the medical device in the body. In this way the coated implants may be used for therapeutic purposes, with the active ingredients applied to the implant being released locally and successively at the site of use of the implant. Active ingredients that can be used in dynamic active ingredient loading for the release of active ingredients include, for example, hydroxyl apatite (HAP), fluorapatite, tricalcium phosphate (TCP), zinc and/or organic substances such as peptides, proteins, carbohydrates such as monosaccharides, oligosaccharides and polysaccharides, lipids, phospholipids, steroids, lipoproteins, glycoproteins, glycolipids, proteoglycans, DNA, RNA, signal peptides or antibodies and/or antibody fragments, bioabsorbable polymers, e.g., polylactic acid, chitosan and the like as well as pharmacologically active substances or substance mixtures.
Suitable pharmacologically active substances or substance mixtures for static and/or dynamic loading of implantable medical devices coated according to this invention include active ingredients or active ingredient combinations selected from heparin, synthetic heparin analogs (e.g., fondaparinux), hirudin, antithrombin III, drotrecogin alpha; fibrinolytics such as alteplase, plasmin, lysokinases, factor XIIa, prourokinase, urokinase, anistreplase, streptokinase; platelet aggregation inhibitors such as acetylsalicylic acid [aspirin], ticlopidine, clopidogrel, abciximab, dextrans;
corticosteroids such as alclometasone, amcinonide, augmented betamethasone, beclomethasone, betamethasone, budesonide, cortisone, clobetasol, clocortolone, desonide, desoximetasone, dexamethasone, fluocinolone, fluocinonide, flurandrenolide, flunisolide, fluticasone, halcinonide, halobetasol, hydrocortisone, methylprednisolone, mometasone, prednicarbate, prednisone, prednisolone, triamcinolone; so-called non-steroidal anti-inflammatory drugs (NSAIDs) such as diclofenac, diflunisal, etodolac, fenoprofen, flurbiprofen, ibuprofen, indomethacin, ketoprofen, ketorolac, meclofenamate, mefenamic acid, meloxicam, nabumetone, naproxen, oxaprozin, piroxicam, salsalate, sulindac, tolmetin, celecoxib, rofecoxib; cytostatics such as alkaloides and podophyllum toxins such as vinblastine, vincristine; alkylating agents such as nitrosoureas, nitrogen lost analogs; cytotoxic antibiotics such as daunorubicin, doxorubicin and other anthracyclines and related substances, bleomycin, mitomycin;
antimetabolites such as folic acid analogs, purine analogs or pyrimidine analogs;
paclitaxel, docetaxel, sirolimus; platinum compounds such as carboplatin, cisplatin or oxaliplatin; amsacrin, irinotecan, imatinib, topotecan, interferon-alpha 2a, interferon-alpha 2b, hydroxycarbamide, miltefosine, pentostatin, porfimer, aldesleukin, bexaroten, tretinoin; antiandrogens and antiestrogens; antiarrythmics in particular class I
antiarrhythmic such as antiarrhythmics of the quinidine type, quinidine, dysopyramide, ajmaline, prajmalium bitartrate, detajmium bitarirate; antiarrhythmics of the lidocaine type, e.g., lidocaine, mexiletin, phenytoin, tocainid; class Ic antiarrhythmics, e.g., propafenon, flecainid(acetate); class II antiarrhythmics beta-receptor blockers such as metoprolol, esmolol, propranolol, metoprolol, atenolol, oxprenolol; class III
antiarrhythmics such as amiodarone, sotalol; class IV antiarrhythmics such as diltiazem, verapamil, gallopamil; other antiarrhythmics such as adenosine, orciprenaline, ipratropium bromide; agents for stimulating angiogenesis in the myocardium such as vascular endothelial growth factor (VEGF), basic fibroblast growth factor (bFGF), non-viral DNA, viral DNA, endothelial growth factors: FGF-1, FGF-2, VEGF, TGF;
antibiotics, monoclonal antibodies, anticalins; stem cells, endothelial progenitor cells (EPC); digitalis glycosides, such as acetyl digoxin/metildigoxin, digitoxin, digoxin;
cardiac glycosides such as ouabain, proscillaridin; antihypertensives such as CNS active antiadrenergic substances, e.g., methyldopa, imidazoline receptor agonists; calcium channel Mockers of the dihydropyridine type such as nifedipine, nitrendipine; ACE inhibitors:
quinaprilate, cilazapril, moexipril, trandolapril, spirapril, imidapril, trandolapril;
angiotensin II
antagonists: candesartancilexetil, valsartan, telmisartan, olmesartamnedoxomil, eprosartan; peripherally active alpha-receptor Mockers such as prazosin, urapidil, doxazosin, bunazosin, terazosin, indoramin; vasodilatators such as dihydralazine, diisopropylamine dichloracetate, minoxidil, nitroprusside sodium; other antihypertensives such as indapamide, co-dergocrine mesylate, dihydroergotoxin methanessulfonate, cicletanin, bosentan, fludrocortisone; phosphodiesterase inhibitors such as milrinon, enoximon and antihypotensives such as in particular adrenergic and dopaminergic substances such as dobutamine, epinephrine, etilefrine, norfenefrine, norepinephrine, oxilofrine, dopamine, midodrine, pholedrine, ameziniummetil;
and partial adrenoceptor agonists such as dihydroergotamine; fibronectin, polylysine, ethylene vinyl acetate, inflammatory cytokines such as: TGF(3, PDGF, VEGF, bFGF, TNFa., NGF, GM-CSF, IGF-a, IL-1, IL-8, IL-6, growth hormone; as well as adhesive substances such as cyanoacrylates, beryllium, silica; and growth factors such as erythropoetin, hormones such as corticotropins, gonadotropins, somatropins, thyrotrophins, desmopressin, terlipressin, pxytocin, cetrorelix, corticorelin, leuprorelin, triptorelin, gonadorelin, ganirelix, buserelin, nafarelin, goserelin, as well as regulatory peptides such as somatostatin, octreotid; bone and cartilage stimulating peptides, bone morphogenetic proteins (BMPs), in particulary recombinant BMPs , such as recombinant human BMP-2 (rhBMP-2), bisphosphonate (e.g., risedronate, pamidronate, ibandronate, zoledronic acid, clodronsaure, etidronsaure, alendronic acid, tiludronic acid), fluorides such as disodium fluorophosphate, sodium fluoride;
calcitonin, dihydrotachystyrol; growth factors and cytokines such as epidermal growth factor (EGF), platelet-derived growth factor (PDGF), fibroblast growth factors (FGFs), transforming growth factors-b (TGFs-b), transforming growth factor-a (TGF-a), erythropoietin (Epo), insulin-like growth factor-I (IGF-I), insulin-like growth factor-II
(IGF-II), interleukin-1 (IL-1), interleukin-2 (IL-2), interleukin-6 (IL-6), interleukin-8 (IL-8), tumor necrosis factor-a (TNF-a), tumor necrosis factor-b (TNF-b), interferon-g (INF-g), colony stimulating factors (CSFs); monocyte chemotactic protein, fibroblast stimulating factor 1, histamine, fibrin or fibrinogen, endothelin-1, angiotensin II, collagens, bromocriptine, methysergide, methotrexate, carbon tetrachloride, thioacetamide and ethanol; as well as silver (ions), titanium dioxide, antibiotics and anti-infective drugs such as in particular (3-lactam antibiotics, e.g., ~3-lactamase-sensitive penicillins such as benzyl penicillins (penicillin G), phenoxymethylpenicillin (penicillin V); (i-lactamase-resistent penicillins such as aminopenicillins, e.g., amoxicillin, ampicillin, bacampicillin; acylaminopenicillins such as mezlocillin, piperacillin; carboxypenicillins, cephalosporins such as cefazoline, cefuroxim, cefoxitin, cefotiam, cefaclor, cefadroxil, cefalexin, loracarbef, cefixim, cefuroximaxetil, ceftibuten, cefpodoximproxetil, cefpodoximproxetil; aztreonam, ertapenem, meropenem; (i-lactamase inhibitors such as sulbactam, sultamicillintosylate;
tetracyclines such as doxycycline, minocycline, tetracycline, chlorotetracycline, oxytetracycline; aminoglycosides such as gentamicin, neomycin, streptomycin, tobramycin, amikacin, netilmicin, paromomycin, framycetin, spectinomycin;
macrolide antibiotics such as azithromycin, clarithromycin, erythromycin, roxithromycin, spiramycin, josamycin; lincosamides such as clindamycin, lincomycin; gyrase inhibitors such as fluoroquinolones, e.g., ciprofloxacin, ofloxacin, moxifloxacin, norfloxacin, gatifloxacin, enoxacin, fleroxacin, levofloxacin; quinolones such as pipemidic acid;
sulfonamides, trimethoprim, sulfadiazine, sulfalene; glycopeptide antibiotics such as vancomycin, teicoplanin; polypeptide antibiotics such as polymyxins, e.g., colistin, polymyxin-b, nitroimidazole derivates, e.g., metronidazole, tinidazole;
aminoquinolones such as chloroquin, mefloquin, hydroxychloroquin; biguanids such as proguanil;
quinine alkaloids and diaminopyrimidines such as pyrimethamine; amphenicols such as chloramphenicol; rifabutin, dapson, fusidic acid, fosfomycin, nifuratel, telithromycin, fusafungin, fosfomycin, pentamidine diisethionate, rifampicin, taurolidin, atovaquon, linezolid; virus static such as aciclovir, ganciclovir, famciclovir, foscarnet, inosine-(dimepranol-4-acetamidobenzoate), valganciclovir, valaciclovir, cidofovir, brivudin;
antiretroviral active ingredients (nucleoside analog reverse-transcriptase inhibitors and derivatives) such as lamivudine, zalcitabine, didanosine, zidovudin, tenofovir, stavudin, abacavir; non-nucleoside analog reverse-transcriptase inhibitors: amprenavir, indinavir, saquinavir, lopinavir, ritonavir, nelfinavir; amantadine, ribavirine, zanamivir, oseltamivir and lamivudine, as well as any combinations and mixtures thereof.
STENTS
Especially preferred embodiments of the present invention include coated vascular endoprostheses (intraluminal endoprostheses) such as stems, coronary stems, intravascular stems, peripheral stems and the like.
These can easily be functionalized in a biocompatible manner by the method according to this invention, so that the residual stenoses which frequently occur in percutaneous transluminal angioplasty with traditional stems can be prevented.
By immobilizing suitable active ingredients on porous carbon-based coatings, in particular paclitaxel, rapamycins or dexamethasone, the local inflammation reaction in the tissue of the vascular wall can be inhibited andlor suppressed by temporary local release of these active ingredients. The use and efficacy of such active ingredients is sufficiently well known according to the state of the art, but the usability has been limited due to the coating systems according to the state of the art, in particular because of the inadequate load capacity which leads to inadequate bioavailability, inadequate, i.e., incomplete release of these active ingredients or intolerance between the coating system and the active ingredient due to unwanted physical or chemical interactions.
In preferred embodiments of the present invention, vitreous carbon layers or composite layers with the addition of carbon black particles with layer thicknesses between 80 nm and 10 pm, pore sizes from 5 nm to 1 pm and porosities of 1% to 70% are produced and activated, preferably by introducing fillers and then removing them from the carbon layer or through the admixture of carbon black particles having a spherical or ellipsoid or rod-shaped morphology and a particle size of 10 nm to 200 nm, these particles creating a porous matrix, so that active ingredients can be accommodated in a sufficient amount. The surface of the stmt implant may be increased here up to 2000 m2/m3.
In preferred embodiments of this invention, by activation of the carbon-based layer, e.g., with air at an elevated temperature, the hydrophilic property of the coating can be increased, which in turn additionally increases the biocompatibility, while on the other hand making the layer better able to uptake active ingredients, in particular hydrophilic active ingredients.
In especially preferred embodiments, stems, in particular coronary stems and peripheral stems may be loaded with pharmacologically active substances or substance mixtures or with cells or cell cultures by the method according to this invention. For example, the carbon-based stmt surfaces may be finished with the following active ingredients to locally suppress cell adhesion, platelet aggregation, complement activation and/or inflammatory tissue reactions or cell proliferation:
Heparin, synthetic heparin analogs (e.g., fondaparinux), hirudin, antithrombin III, drotrecogin alpha, fibrinolytics (alteplase, plasmin, lysokinases, factor XIIa, prourokinase, urokinase, anistreplase, streptokinase), platelet aggregation inhibitors (acetylsalicylic acid [aspirin], ticlopidine, clopidogrel, abciximab, dextran), corticosteroids (alclometasone, amcinonide, augmented betamethasone, beclomethasone, betamethasone, budesonide, cortisone, clobetasol, clocortolone, desonide, desoximetasone, dexamethasone, fluocinolone, fluocinonide, flurandrenolide, flunisolide, fluticasone, halcinonide, halobetasol, hydrocortisone, methylprednisolone, mometasone, prednicarbate, prednisone, prednisolone, triamcinolone), so-called non-steroidal anti-inflammatory drugs [NSAIDs] (diclofenac, diflunisal, etodolac, fenoprofen, flurbiprofen, ibuprofen, indomethacin, ketoprofen, ketorolac, meclofenamate, mefenamic acid, meloxicam, nabumetone, naproxen, oxaprozin, piroxicam, salsalate, sulindac, tolmetin, celecoxib, rofecoxib), cytostatics (alkaloids and podophyllum toxins such as vinblastine, vincristine; alkylating agents such as nitrosoureas, nitrogen lost analogs; cytotoxic antibiotics such as daunorubicin, doxorubicin and other anthracyclines and related substances, bleomycin, mitomycin;
antimetabolites such as folic acid, purine or pyrimidine analogs; paclitaxel, docetaxel, sirolimus; platinum compounds such as carboplatin, cisplatin or oxaliplatin;
amsacrin, irinotecan, imatinib, topotecan, interferon-alpha 2a, interferon-alpha 2b, hydroxycarbamide, miltefosine, pentostatin, porfimer, aldesleukin, bexaroten, tretinoin;
antiandrogens and antiestrogens).
Stems activated according to this invention may be loaded with any of the following for their systemic cardiological effects:
Antiarrythmics, in particular class I antiarrhythmics (antiarrhythmics of the quinidine type: quinidine, dysopyramide, ajmaline, prajmalium bitartrate, detajmium bitartrate;
antiarrhythmics of the lidocaine type: lidocaine, mexiletin, phenytoin, tocainid; class I C
antiarrhythmics: propafenon, flecainide (acetate)), class II antiarrhythmics (beta-receptor blockers) (metoprolol, esmolol, propranolol, metoprolol, atenolol, oxprenolol), class III antiarrhythmics (amiodaron, sotalol), calss IV antiarrhythmics (diltiazem, verapamil, gallopamil), other antiarrhythmics such as adenosine, orciprenaline, ipratropium bromide; stimulation of angiogenesis in the myocardium: vascular endothelial growth factor (VEGF), basic fibroblast growth factor (bFGF), nonviral DNA, viral DNA, endothelial growth factors: FGF-l, FGF-2, VEGF, TGF;
antibodies, monoclonal antibodies, anticalins; stem cells, endothelial progenitor cells (EPC). Other cardiac agents include: digitalis glycosides (acetyldigoxin/metildigoxin, digitoxin, digoxin), other cardiac glycosides (ouabain, proscillaridin). In addition the stems may be loaded antihypertensives (CNS active antiadrenergic substances; methyldopa, imidazoline receptor agonists; calcium channel blocker of the dihydropyridine type such as nifedipine, nitrendipine; ACE inhibitors: quinaprilat, cilazapril, moexipril, trandolapril, spirapril, imidapril, trandolapril; angiotensin II antagonists:
candesartancilexetil, valsartan, telmisartan, olmesartanmedoxomil, eprosartan;
peripheral acting alpha-receptor Mockers: prazosin, urapidil, doxazosin, bunazosin, terazosin, indoramin; vasodilators: dihydralazine, diisopropylamine dichloracetate, minoxidil, nitroprusside sodium), other antihypertensives such as indapamide, co-dergocrine mesylate, dihydroergotoxin methane sulfonate, cicletanin, bosentan.
In addition, phosphodiesterase inhibitors (milrinon, enoximon) and antihypotensives, here in particular adrenergic and dopaminergic substances (dobutamine, epinephrine, etilefrine, norfenefrine, norepinephrine, oxilofrine, dopamine, midodrine, pholedrine, amezinium meth), partial adrenoceptor agonists (dihydroergotamine), and finally other antihypotensives such as fludrocortisone may also be used.
To increase tissue adhesion, in particular in the case of peripheral stems, components of the extracellular matrix, fibronectin" polylysine, ethylene vinyl acetate, inflammatory cytokines such as: TGF(3, PDGF, VEGF, bFGF, TNFa, NGF, GM-CSF, IGF-a, IL-1, IL-8, IL-6, growth hormones and adhesive substances such as cyanoacrylates, beryllium or silica may also be used.
Other substances suitable for here and having a systemic and/or local effect include growth factors and erythropoetin.
Hormones may also be provided in the stmt coatings such as corticotropins, gonadotropins, somatropin, thyrotrophin, desmopressin, terlipressin, oxytocin, cetrorelix, corticorelin, leuprorelin, triptorelin, gonadorelin, ganirelix, buserelin, nafarelin, goserelin, and regulatory peptides such as somatostatin and/or octreotid.
Other embodiments provide for functionalization by loading the carbon surfaces with cells, e.g., with pluripotent stem cells, endothelial cells or connective tissue cells which may be obtained from organisms, cultured from cell cultures in the laboratory or modified by genetic engineering.
For example in a special embodiment, vascular implants provided with activated carbon layers may be loaded with endothelial cell cultures by first using them as a substrate in a bioreactor and/or as a culturing and carrier system for cell cultures.
Suitable methods here include those described in German Patent DE 103 35 131, i.e., PCT/EP04/00077, the disclosure content is herewith included.
For example, inventive nanoporous activated carbon layers with a surface area of 200 to 3000 m2/m3 can be loaded with endothelial cells after culturing, in which case the possible cell densities range from 101 to 1016 cells/mL layer volume, preferably 103 to 1012 cells/mL.
ORTHOPEDIC IMPLANTS
In the case of surgical and orthopedic implants, it may be advantageous to activate the implants with one or more carbon-based layers so that the layers are macroporous.
Suitable pore sizes are in the range of 0.1 to 1000 Vim, preferably 1 to 400 pm to support better integration of the implants by incorporation into the surrounding cell tissue or bone tissue.

For orthopedic and nonorthopedic implants as well as heart valves or synthetic heart parts functionalized according to this invention, if they are to be loaded with active ingredients, the same active ingredients may be used as those listed for the stmt applications described above or local suppression of cell adhesion, platelet aggregation, complement activation and/or inflammatory tissue reaction or cell proliferation.
Furthermore, for stimulation of tissue growth in particular in the case of orthopedic implants, the following active ingredients may be used to improve implant integration:
bone and cartilage stimulating peptides, bone morphogenetic proteins (BMPs), in particular recombinant BMPs (e.g., recombinant human BMP-2 (rhBMP-2)), bisphosphonates (e.g., risedronate, pamidronate, ibandronate, zoledronic acid, clodronic acid, etidronic acid, alendronic acid, tiludronic acid), fluorides (disodium fluorophosphate, sodium fluoride); calcitonin, dihydrotachystyrene. Then all the growth factors and cytokines may be used (epidermal growth factor (EGF), platelet-derived growth factor (PDGF), fibroblast growth factors (FGFs), transforming growth factors-b (TGFs-b), transforming growth factor-a (TGF-a), erythropoietin (Epo), insulin-like growth factor I (IGF-I), insulin-like growth factor II (IGF-II), interleukin-1 (IL-1), interleukin-2 (IL-2), interleukin-6 (IL-6), interleukin-8 (IL-8), tumor necrosis factor-a (TNF-a), tumor necrosis factor-b (TNF-b), Interferon-g (INF-g), colony stimulating factors (CSFs)). In addition to the inflammatory cytokines mentioned above, other adhesion-promoting and integration-promoting substances include the monocyte chemotactic protein, fibroblast stimulating factor 1, histamine, fibrin or fibrinogen, endothelin-1, angiotensin II, collagens, bromocriptine, methysergide, methotrexate, carbon tetrachloride, thioacetamide, ethanol.
SPECIAL EMBODIMENTS
In addition, the implants, stems and the like that have been activated according to this invention may also be provided with antibacterial-antiinfectious coatings or impregnation instead of or in addition to pharmaceutical drugs, in which case the following substances or substance mixtures may be used: silver (ions), titanium dioxide, antibiotics and antiinfective agents. In particular these include beta-lactam antibiotics ((3-lactam antibiotics: ~3-lactamase-sensitive penicillins such as benzyl penicillins (penicillin G), phenoxymethyl penicillin (penicillin ~); ~i-lactamase-resistant penicillins such as aminopenicillins, e.g., amoxicillin, ampicillin, bacampicillin;
acylaminopenicillins such as mezlocillin, piperacillin; carboxypenicillins, cephalosporins (cefazolin, cefuroxim, cefoxitin, cefotiam, cefaclor, cefadroxil, cefalexin, loracarbef, cefixim, cefuroximaxetil, ceftibuten, cefpodoximproxetil, cefpodoximproxetil) or other such as aztreonam, ertapenem, meropenem. Other antibiotics that may be used include (3-lactamase inhibitors (sulbactam, sultamicillintosylate), tetracyclins (doxycyclin, minocyclin, tetracyclin, chlortetracyclin, oxytetracyclin), aminoglycosides (gentamicin, neomycin, streptomycin, tobramycin, amikacin, netilmicin, paromomycin, framycetin, spectinomycin), macrolide antibiotics (azithromycin, clarithromycin, erythromycin, roxithromycin, spiramycin, josamycin), lincosamids (clindamycin, lincomycin), gyrase inhibitors (fluoroquinolones such as ciprofloxacin, ofloxacin, moxifloxacin, norfloxacin, gatifloxacin, enoxacin, fleroxacin, levofloxacin; other quinolones such as pipemidic acid), sulfonamids and trimethoprim (sulfadiazin, sulfalen, trimethoprim), glycopeptide antibiotics (vancomycin, teicoplanin), polypeptide antibiotics (polymyxins such as colistin, polymyxin-b), nitroimidazole derivates ( metronidazole, tinidazole), aminoquinolones (chloroquin, mefloquin, hydroxychloroquin), biguanids (proguanil), quinine alkaloids and diaminopyrimidines (pyrimethamine), amphenicols (chloramphenicol) and other antibiotics (rifabutin, dapson, fusidinic acid, fosfomycin, nifuratel, telithromycin, fusafungin, fosfomycin, pentamidine diisethionate, rifampicin, taurolidine, atovaquone, linezolide). Examples of virus statics that can be mentioned include aciclovir, ganciclovir, famciclovir, foscarnet, inosine-(dimepranol-4-acetamidobenzoate), valganciclovir, valaciclovir, cidofovir, brivudin. This also include antiretroviral active ingredients (nucleoside analog reverse-transcriptase inhibitors and derivatives:
lamivudine, zalcitabine, didanosine, zidovudin, tenofovir, stavudin, abacavir;
non-nucleoside analog reverse-transcriptase inhibitors: amprenavir, indinavir, saquinavir, lopinavir, ritonavir, nelfinavir) and other virustatics such as amantadin, ribavirin, zanamivir, oseltamivir, lamivudin.
In especially preferred embodiments of the present invention, the inventive implants may be suitably modified in their chemical or physical properties with carbon-based layers before or after loading of the active ingredient by using other agents, e.g., to modify the hydrophilicity, hydrophobicity, electric conductivity, adhesion or other surface properties. Substances that can be used for this purpose include biodegradable or non-degradable polymers such as for the biodegradable polymers: collagens, albumin, gelatin, hyaluronic acid, starch, cellulose (methyl cellulose, hydroxypropyl cellulose, hydroxypropylmethyl cellulose, carboxymethyl cellulose phthalate;
also casein, dextrans, polysaccharides, fibrinogen, poly(D,L-lactides), poly(D,L-lactide-co-glycolide), poly(glycolides), poly(hydroxybutylates), poly(alkyl carbonates), poly(ortho esters), polyesters, poly(hydroxyvaleric acid), polydioxanones, polyethylene terephtalate), poly(malic acid), poly(tartronic acid), polyanhydride, polyphosphohazenes, poly(amino acids) and all their copolymers.
The non-biodegradable polymers include: polyethylene vinyl acetates), silicones, acrylic polymers such as polyacrylic acid, polymethyl acrylic acid, polyacryl cyanoacrylate; polyethylenes, polypropylenes, polyamides, polyurethanes, polyester urethanes), poly(ether urethanes), polyester ureas), polyethers such as polyethylene oxide, polypropylene oxide, pluronics, polytetramethylene glycol; vinyl polymers such as polyvinylpyrrolidones, polyvinyl alcohols), polyvinyl acetate phthalate);
parylenes.
It is true in general that polymers with anionic properties (e.g., alginate, carrageenan, carboxymethyl cellulose) or cationic (e.g., chitosan, poly-L-lysine, etc.) or both properties (phosphorylcholine) can be produced.
These polymers can be applied to the surface of the implants and may cover them partially or entirely.
To modify the release properties of inventive implants containing one or more active ingredients, specific pH-dependent or temperature-dependent release properties can be achieved by applying additional polymers, for example. Examples of pH-sensitive polymers include poly(acrylic acid) and derivatives thereof, e.g., homopolymers such as poly(aminocarboxylic acid), poly(acrylic acid), poly(methyl acrylic acid) and copolymers thereof. This is also true of polysaccharides such as cellulose acetate phthalate, hydroxypropylmethyl cellulose phthalate, hydroxypropylmethyl cellulose succinate, cellulose acetate trimellitate and chitosan. Thermally sensitive polymers include for example poly(N-isopropylacrylamide-co-sodium acrylate-co-n-N-alkyl-acrylamide), poly(N-methyl-N-n-propylacrylamide), poly(N-methyl-N-isopropyl-acrylamide), poly(N-n-propylmethacrylamide), poly(N-isopropylacrylamide), poly(N,n-diethylacrylamide), poly(N-isopropylmethacrylamide), poly(N-cyclopropylacrylamide), poly(N-ethyl-acrylamide), poly(N-ethyl-methyacrylamide), poly(N-methyl-N-ethylacrylamide), poly(N-cyclopropylacrylamide). Other polymers with thermogel characteristics include hydroxypropyl cellulose, methyl cellulose, hydroxypropylmethyl cellulose, ethylhydroxyethyl cellulose and pluronics such as F-127, L-122, L-92, L-81, L-61.
The active ingredients may be adsorbed in the pores of the carbon-based layer (covalently, non-covalently) in which case their release can be controlled primarily through pore size and pore geometry. Additional modifications of the porous chemical layer by chemical modification (anionic, cationic) make it possible to modify the release, e.g., as a function of pH. The release of Garners that contain active ingredient also constitutes another application namely microcapsules, liposomes, nanocapsules, nanoparticles, micelles, synthetic phospholipids, gas dispersions, emulsions, microemulsions, nanospheres etc., which are adsorbed in the pores of the carbon layer and are then released therapeutically. By additional covalent or non-covalent modification of the carbon layer, the pores can be occluded so that bioactive ingredients are protected. Possibilities include the above-mentioned polysaccharides, lipids, etc., but also the polymers mentioned above.
Therefore, in the additional coating of the porous carbon-based layers produced according to this invention with additional layers, a distinction may be made between physical barners such as inert biodegradable substances (poly-L-lysine, fibronectin, chitosan, heparin, etc.) and biologically active barners. The latter may be sterically hindering molecules which are physiologically bioactivated and which permit the release of active ingredients and/or their vehicles. Examples include enzymes which mediate the release, activate biologically active substances or bind inactive coatings and lead to exposure of active ingredients. All this specific mechanisms and properties listed here can be applied to the primary carbon layer as well as additional layers applied thereto.
By applying the release-modifying polymer layers mentioned above and/or by adapting the pore structure of the carbon-based layer, it is possible to control the release of the active ingredients from the implant in a wide range. achievable release times include up to twelve hours, up to one or more years, preferably 24 hours, 48 hours, 96 hours, one week, two weeks, one month, three months.
The inventive implants may also be loaded with live cells or microorganisms in special applications and may be functionalized in this way. These cells or microorganisms may form colonies in suitably porous carbon-based layers and the implant colonized in this way may be provided with a suitable membrane coating which is permeable for nutrients and active ingredients produced by cells or microorganisms but is not permeable for the cells themselves. Thus the cells or microorganisms can be supplied from the organism through the membrane coating.

For example, by using the inventive technology in this way, it is possible to produce implants which contain insulin-producing cells that produce and release insulin according to the prevailing glucose level after being implanted in the body.

Claims (29)

1. A method for producing medical implants having functionalized surfaces comprising the following steps:

a) providing a medical implant with at least one carbon-based layer on at least part of the surface of the implant;

b) activating the carbon-based layer by creating porosity;

c) functionalizing the activated carbon-based layer.
2. The method according to Claim 1, characterized in that the carbon-based layer is selected from pyrolytically produced carbon, vapor-deposited carbon, carbon applied by CVD, PVD or sputtering, metal carbides, metal carbonitrides, metal oxynitrides or metal oxycarbides as well as any desired combinations thereof.
3. The method according to Claim 1 or 2, characterized in that the implant consists of a material which is selected from carbon, carbon composite material, carbon fibers, ceramic, glass, plastics, metals, alloys, bone, stone or minerals.
4. The method according to any one of the preceding claims, characterized in that the implant is selected from medical or therapeutic implants such as vascular endoprostheses, stents, coronary stems, peripheral stents, surgical or orthopedic implants, bone prostheses or joint prostheses, artificial hearts, artificial heart valves, subcutaneous and/or intramuscular implants.
5. The method according to any one of the preceding claims, characterized in that activation of the carbon-based layer is performed with suitable oxidizing agents and/or reducing agents.
6. The method according to any one of the preceding claims, characterized in that the carbon-based layer is activated by oxidation with air, oxygen, nitrous oxide, and/or oxidizing acids, optionally at an elevated temperature.
7. The method according to any one of the preceding claims, characterized in that the activation is performed by abrasion in an aqueous ultrasonic bath with the addition of alumina, silicates and/or aluminates.
8. The method according to any one of the preceding claims, characterized in that activation causes the carbon-based layer to become porous, preferably macroporous with pore diameters in the range of 0.1 to 1000 pin, optionally also by prestructuring the substrate.
9. The method according to any one of the preceding claims, characterized in that activation causes the carbon-based layer to become nanoporous.
10. The method according to any one of the preceding claims, characterized in that the activate porous carbon-based layer is subsequently compressed and/or sealed by CVD and/or CVI of volatile organic substances.
11. The method according to any one of the preceding claims, characterized in that the functionalization of the activated carbon-based layer comprises loading the layer with at least one substance selected from pharmacological active ingredients, linkers, microorganisms, plant or animal cells including human cells or cell cultures and tissue, minerals, salts, metals, synthetic or natural polymers, proteins, peptides, amino acids, solvents, ions, cations, in particular metal cations such as cobalt, nickel, copper, zinc cations, antibodies, calmodulin, chitin, cellulose, sugars, amino acids, glutathione, streptavidin, Strep-Tactin or other mutants or S protein, dextrans, as well as their derivatives, mixtures and combinations.
12. The method according to any one of the preceding claims, characterized in that the functionalization is performed by adsorption of substances corresponding to affinity tags in and/or on the carbon-based layer, whereby the corresponding substances are selected so that they can enter into a bond with the affinity tags.
13. The method according to Claim 11 or 12, characterized in that the substance(s) is/are applied to and/or immobilized on the carbon-based layer by adsorption, absorption, physisorption, chemisorption, electrostatic covalent bonding or non-covalent bonding.
14. The method according to Claim 11, characterized in that the at least one substance is essentially permanently immobilized on the carbon-based layer(s).
15. The method according to Claim 11, characterized in that the at least one substance applied to the carbon-based layer, in particular a pharmacological active ingredient, can be released from the layer in a controlled manner.
16. The method according to Claim 15, characterized in that the pharmacologically active substances are incorporated into microcapsules, liposomes, nanocapsules, nanoparticles, micelles, synthetic phospholipids, gas dispersions, emulsions, microemulsions or nanospheres which are adsorbed in the pores or on the surface of the carbon-based layer and can then be released therapeutically.
17. The method according to any one of Claims 14 through 16, characterized in that the a coating which influences the release of the active ingredient is also applied, selected from pH-sensitive and/or temperature-sensitive polymers and/or biologically active barriers such as enzymes.
18. The method according to any one of the preceding claims, characterized in that the functionalization includes applying biodegradable and/or absorbable polymers such as collagen, albumin, gelatin, hyaluronic acid, starch, celluloses such as methyl cellulose hydroxypropyl cellulose, hydroxypropylmethyl cellulose, carboxymethylcellulose phthalate; casein, dextrans, polysaccharides, fibrinogen, poly(D,L-lactide), poly(D,L-lactide-co-glycolide), poly(glycolide), poly(hydroxybutylate), poly(alkyl carbonate), poly(orthoester), polyester, poly(hydroxyvaleric acid), polydioxanone, polyethylene terephtalate), poly(malic acid), poly(tartronic acid), polyanhydrides, polyphosphazenes, poly(amino acids) and their copolymers.
19. The method according to any one of the preceding claims, characterized in that the functionalization includes applying non-biodegradable and/or non-absorbable polymers such as poly(ethylene vinyl acetate), silicones, acrylic polymers such as polyacrylic acid, polymethyl acrylic acid, polyacryl cyanoacrylate; polyethylenes, polypropylenes, polyamides, polyurethanes, poly(ester urethanes), poly(ether urethanes), poly(ester ureas), polyethers, polyethylene oxide, polypropylene oxide, pluronics, polytetramethylene glycol;
vinyl polymers such as polyvinylpyrrolidones, poly(vinyl alcohols), polyvinyl acetate phthalate) as well as their copolymers.
20. An implant having a functionalized surface producible according to any one of the preceding claims.
21. The implants according to Claim 20, characterized in that it is made of metals such as stainless steel, titanium, tantalum, platinum, gold, palladium, alloys, in particular memory alloys such as nitinol or nickel titanium alloys or carbon fibers, solid carbon material or carbon composites.
22. The implant according to any one of Claims 20 or 21 comprising multiple carbon-based layers optionally loaded with active ingredient.
23. A device according to any one of Claims 20 though 22, also comprising anionic or cationic or amphoteric coatings selected from alginate, carrageenan, carboxymethyl cellulose, poly(meth)acrylates, chitosan, poly-L-lysines and/or phosphorylcholine.
24. A stent coated with an active ingredient according to any one of Claims 20 through 23.
25. A heart valve coated with an active ingredient according to any one of Claims 20 through 23.
26. The implant according to any one of Claims 20 through 23 in the form of an orthopedic bone prosthesis or joint prosthesis, a bone substitute or a vertebral substitute in the thoracic or lumbar region of the spinal column.
27. An active ingredient depot with controlled release that can be used subcutaneously and/or intramuscularly according to any one of Claims 20 through 23.
28. The implant according to any one of Claims 20 through 27, comprising applied and/or incorporated microorganisms, viral vectors or cells or tissue.
29. A use of an implant according to Claim 28 for producing a therapeutic effect or for increasing the bioavailability of the implant after implantation of the implant in the human body.
CA002519750A 2003-05-28 2004-05-28 Implants with functionalized carbon surfaces Abandoned CA2519750A1 (en)

Applications Claiming Priority (7)

Application Number Priority Date Filing Date Title
DE10324415.8 2003-05-28
DE2003124415 DE10324415A1 (en) 2003-05-28 2003-05-28 Coating procedure for coating substrates with carbon based material, comprises carbonation of polymer film in oxygen free environment at temperature ranging from 200 to 2500 degrees Celsius
DE2003133098 DE10333098A1 (en) 2003-07-21 2003-07-21 New biocompatible, coated, implantable medicinal devices, e.g. stents, obtained by thermally carbonizing a polymeric coating, useful e.g. for controlled drug release
DE10333099.2 2003-07-21
DE10333098.4 2003-07-21
DE10333099A DE10333099A1 (en) 2003-07-21 2003-07-21 Medicinal implants, e.g. stents, with a functionalized surface, obtained by activating a carbon-containing coating to provide porosity then functionalizing, useful e.g. for controlled drug release
PCT/EP2004/005785 WO2004105826A2 (en) 2003-05-28 2004-05-28 Implants comprising functionalized carbon surfaces

Publications (1)

Publication Number Publication Date
CA2519750A1 true CA2519750A1 (en) 2004-12-09

Family

ID=32872363

Family Applications (1)

Application Number Title Priority Date Filing Date
CA002519750A Abandoned CA2519750A1 (en) 2003-05-28 2004-05-28 Implants with functionalized carbon surfaces

Country Status (18)

Country Link
US (1) US20050079201A1 (en)
EP (2) EP2033666A2 (en)
JP (1) JP2007502184A (en)
KR (1) KR20060015624A (en)
AT (1) ATE410196T1 (en)
AU (1) AU2004243503A1 (en)
BR (1) BRPI0410957A (en)
CA (1) CA2519750A1 (en)
DE (2) DE502004008211D1 (en)
DK (1) DK1626749T3 (en)
EA (1) EA009836B1 (en)
ES (1) ES2315661T3 (en)
HK (1) HK1089702A1 (en)
MX (1) MXPA05011231A (en)
PL (1) PL1626749T3 (en)
PT (1) PT1626749E (en)
SI (1) SI1626749T1 (en)
WO (1) WO2004105826A2 (en)

Families Citing this family (112)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040081704A1 (en) * 1998-02-13 2004-04-29 Centerpulse Biologics Inc. Implantable putty material
US7713297B2 (en) 1998-04-11 2010-05-11 Boston Scientific Scimed, Inc. Drug-releasing stent with ceramic-containing layer
US20020114795A1 (en) 2000-12-22 2002-08-22 Thorne Kevin J. Composition and process for bone growth and repair
US7666462B2 (en) * 2001-05-11 2010-02-23 Exogenesis Corporation Method of controlling a drug release rate
US7238478B2 (en) * 2003-11-13 2007-07-03 Stratagene California Compositions and methods for protein isolation
JP4566189B2 (en) * 2004-03-15 2010-10-20 テルモ株式会社 Anti-adhesive material
US8557343B2 (en) 2004-03-19 2013-10-15 The Boeing Company Activation method
EP1753429A1 (en) * 2004-05-28 2007-02-21 Vertex Pharmaceuticals Incorporated Modulators of muscarinic receptors
US8512734B2 (en) 2004-07-05 2013-08-20 Katholieke Universiteit Leuven, K.U.Leuven R&D Biocompatible coating of medical devices
EP1784270A4 (en) * 2004-09-05 2014-01-01 Friction Control Solutions Ltd Working surface, and system and method for production thereof
AT501408B1 (en) * 2004-12-07 2011-03-15 Physikalisches Buero Steinmueller Gmbh BIOLOGICAL SURFACES
US20060127443A1 (en) * 2004-12-09 2006-06-15 Helmus Michael N Medical devices having vapor deposited nanoporous coatings for controlled therapeutic agent delivery
US20060129215A1 (en) * 2004-12-09 2006-06-15 Helmus Michael N Medical devices having nanostructured regions for controlled tissue biocompatibility and drug delivery
KR20070104574A (en) * 2004-12-30 2007-10-26 신벤션 아게 Combination comprising an agent providing a signal, an implant material and a drug
EP2014708A1 (en) 2005-01-13 2009-01-14 Cinvention Ag Shaped body made of a composite material
DE602006012798D1 (en) 2005-01-21 2010-04-22 Commw Scient Ind Res Org ACTIVATION PROCEDURE USING A MODIFYING AGENT
US8057543B2 (en) 2005-01-28 2011-11-15 Greatbatch Ltd. Stent coating for eluting medication
CA2593043A1 (en) * 2005-02-03 2006-08-10 Cinvention Ag Drug delivery materials made by sol/gel technology
JP2008532913A (en) * 2005-03-18 2008-08-21 シンベンション アーゲー Process for the preparation of porous sintered metal materials
DE102005019458A1 (en) * 2005-04-25 2006-10-26 Grünenthal GmbH Composition, useful in the preparation of pellets and the multi-particular-presentation form, comprises cefuroximaxetil and carrageenan of the group of lambda carrageenan, tau carrageenan and kappa carrageenan
EP1902087A1 (en) * 2005-07-01 2008-03-26 Cinvention Ag Process for the production of porous reticulated composite materials
MX2008000131A (en) * 2005-07-01 2008-04-04 Cinv Ag Medical devices comprising a reticulated composite material.
DE202006006920U1 (en) * 2006-04-25 2007-08-30 Biomed Est. Orthopedic anchoring system, for fixation of long bone e.g. tibia, fracture, has two lateral implants, where each implant includes base and post that are arranged orthogonally and coated with active substances
US20070073385A1 (en) * 2005-09-20 2007-03-29 Cook Incorporated Eluting, implantable medical device
EP1957427A4 (en) * 2005-10-28 2011-03-23 Biomedflex Llc Resilient thin film treatment of superelastic and shape memory metal components
US20090258782A1 (en) * 2005-12-09 2009-10-15 Drexel University Mesoporous carbons
US20070154514A1 (en) * 2005-12-30 2007-07-05 Demakas John J Therapeutic Structures
US7862897B2 (en) * 2006-01-27 2011-01-04 Carbon Ceramics Company, Llc Biphasic nanoporous vitreous carbon material and method of making the same
US20070191931A1 (en) * 2006-02-16 2007-08-16 Jan Weber Bioerodible endoprostheses and methods of making the same
US9526814B2 (en) * 2006-02-16 2016-12-27 Boston Scientific Scimed, Inc. Medical balloons and methods of making the same
WO2007106438A2 (en) * 2006-03-10 2007-09-20 Versilant Nanotechnologies Llc Methods of manufacturing highly polished gemstones
US20070270970A1 (en) * 2006-03-14 2007-11-22 Sdgi Holdings, Inc. Spinal implants with improved wear resistance
US20070270971A1 (en) * 2006-03-14 2007-11-22 Sdgi Holdings, Inc. Intervertebral prosthetic disc with improved wear resistance
US20070224235A1 (en) 2006-03-24 2007-09-27 Barron Tenney Medical devices having nanoporous coatings for controlled therapeutic agent delivery
US8187620B2 (en) 2006-03-27 2012-05-29 Boston Scientific Scimed, Inc. Medical devices comprising a porous metal oxide or metal material and a polymer coating for delivering therapeutic agents
US20070233246A1 (en) * 2006-03-31 2007-10-04 Sdgi Holdings, Inc. Spinal implants with improved mechanical response
US7709045B2 (en) * 2006-04-28 2010-05-04 Boston Scientific Scimed, Inc. Medical devices coated with porous carbon and methods of manufacturing the same
CN100447319C (en) * 2006-06-08 2008-12-31 利芳建医药科技咨询(上海)有限公司 Medical protein fiber for preventing and treating proliferation of mammal gland and its preparation method and application
US8815275B2 (en) 2006-06-28 2014-08-26 Boston Scientific Scimed, Inc. Coatings for medical devices comprising a therapeutic agent and a metallic material
US8771343B2 (en) 2006-06-29 2014-07-08 Boston Scientific Scimed, Inc. Medical devices with selective titanium oxide coatings
US20080021462A1 (en) * 2006-07-24 2008-01-24 Warsaw Orthopedic Inc. Spinal stabilization implants
US20080021557A1 (en) * 2006-07-24 2008-01-24 Warsaw Orthopedic, Inc. Spinal motion-preserving implants
WO2008033711A2 (en) 2006-09-14 2008-03-20 Boston Scientific Limited Medical devices with drug-eluting coating
US20080069858A1 (en) * 2006-09-20 2008-03-20 Boston Scientific Scimed, Inc. Medical devices having biodegradable polymeric regions with overlying hard, thin layers
CA2668408A1 (en) * 2006-11-03 2008-05-15 Boston Scientific Limited Ion bombardment of medical devices
US7981150B2 (en) 2006-11-09 2011-07-19 Boston Scientific Scimed, Inc. Endoprosthesis with coatings
US7718616B2 (en) 2006-12-21 2010-05-18 Zimmer Orthobiologics, Inc. Bone growth particles and osteoinductive composition thereof
US8052903B2 (en) * 2006-12-25 2011-11-08 Christopher Whitmarsh Vitreous carbon material and process for making the same
BRPI0806916A2 (en) * 2007-01-19 2014-04-29 Cinv Ag NON-DEGRADABLE POROUS IMPLANT MADE BY DUST
DE102007007865A1 (en) 2007-02-14 2008-08-21 Jennissen, Herbert, Prof. Dr. Process for the preparation of storable implants with an ultrahydrophilic surface
US8431149B2 (en) 2007-03-01 2013-04-30 Boston Scientific Scimed, Inc. Coated medical devices for abluminal drug delivery
US8070797B2 (en) 2007-03-01 2011-12-06 Boston Scientific Scimed, Inc. Medical device with a porous surface for delivery of a therapeutic agent
US20100167401A1 (en) * 2007-03-19 2010-07-01 Vasif Hasirci Stacked, patterned biomaterials and/or tissue engineering scaffolds
US8067054B2 (en) 2007-04-05 2011-11-29 Boston Scientific Scimed, Inc. Stents with ceramic drug reservoir layer and methods of making and using the same
US7976915B2 (en) 2007-05-23 2011-07-12 Boston Scientific Scimed, Inc. Endoprosthesis with select ceramic morphology
US7942926B2 (en) * 2007-07-11 2011-05-17 Boston Scientific Scimed, Inc. Endoprosthesis coating
US8002823B2 (en) 2007-07-11 2011-08-23 Boston Scientific Scimed, Inc. Endoprosthesis coating
US9284409B2 (en) 2007-07-19 2016-03-15 Boston Scientific Scimed, Inc. Endoprosthesis having a non-fouling surface
US8815273B2 (en) 2007-07-27 2014-08-26 Boston Scientific Scimed, Inc. Drug eluting medical devices having porous layers
US7931683B2 (en) 2007-07-27 2011-04-26 Boston Scientific Scimed, Inc. Articles having ceramic coated surfaces
US8221822B2 (en) 2007-07-31 2012-07-17 Boston Scientific Scimed, Inc. Medical device coating by laser cladding
WO2009020520A1 (en) 2007-08-03 2009-02-12 Boston Scientific Scimed, Inc. Coating for medical device having increased surface area
US7883736B2 (en) * 2007-09-06 2011-02-08 Boston Scientific Scimed, Inc. Endoprostheses having porous claddings prepared using metal hydrides
US8845751B2 (en) * 2007-09-21 2014-09-30 Waldemar Link Gmbh & Co. Kg Endoprosthesis component
US7938855B2 (en) * 2007-11-02 2011-05-10 Boston Scientific Scimed, Inc. Deformable underlayer for stent
US8216632B2 (en) 2007-11-02 2012-07-10 Boston Scientific Scimed, Inc. Endoprosthesis coating
US8029554B2 (en) 2007-11-02 2011-10-04 Boston Scientific Scimed, Inc. Stent with embedded material
US20090118818A1 (en) * 2007-11-02 2009-05-07 Boston Scientific Scimed, Inc. Endoprosthesis with coating
JP5581311B2 (en) 2008-04-22 2014-08-27 ボストン サイエンティフィック サイムド,インコーポレイテッド MEDICAL DEVICE HAVING INORGANIC MATERIAL COATING AND MANUFACTURING METHOD THEREOF
US8932346B2 (en) 2008-04-24 2015-01-13 Boston Scientific Scimed, Inc. Medical devices having inorganic particle layers
WO2009155328A2 (en) 2008-06-18 2009-12-23 Boston Scientific Scimed, Inc. Endoprosthesis coating
AU2009200540A1 (en) * 2008-07-03 2010-01-21 Induce Biologics Inc. Use of immobilized antagonists for enhancing growth factor containing bioimplant effectiveness
DE102008040786A1 (en) * 2008-07-28 2010-02-04 Biotronik Vi Patent Ag Biocorrodible implant with a coating containing a drug-carrying polymer matrix
EP2326356B1 (en) 2008-08-07 2017-10-11 Exogenesis Corporation Medical device for bone implant and method for producing such a device
US20100070013A1 (en) * 2008-09-18 2010-03-18 Medtronic Vascular, Inc. Medical Device With Microsphere Drug Delivery System
JP2012504445A (en) * 2008-10-02 2012-02-23 フジフィルム・マニュファクチュアリング・ヨーロッパ・ベスローテン・フエンノートシャップ Antimicrobial coating
US20100131051A1 (en) * 2008-11-24 2010-05-27 Medtronic Vascular, Inc. Systems and Methods for Treatment of Aneurysms Using Zinc Chelator(s)
US8231980B2 (en) 2008-12-03 2012-07-31 Boston Scientific Scimed, Inc. Medical implants including iridium oxide
KR101087088B1 (en) 2008-12-29 2011-11-25 한국과학기술연구원 Method for preparing drug-eluting stent having nano-structured pattern and drug-eluting stent prepared therefrom
US8071156B2 (en) 2009-03-04 2011-12-06 Boston Scientific Scimed, Inc. Endoprostheses
US20100233227A1 (en) * 2009-03-10 2010-09-16 Boston Scientific Scimed, Inc. Medical devices having carbon drug releasing layers
US8287937B2 (en) 2009-04-24 2012-10-16 Boston Scientific Scimed, Inc. Endoprosthese
DE102009024616A1 (en) * 2009-06-08 2010-12-23 Telos Gmbh Sterilizable coating used for complete or partial treatment of surfaces of implantable materials for use as implants or hard tissue replacement materials in medical and dental field, comprises osteogenic protein and ionic polysaccharide
FR2949688B1 (en) * 2009-09-04 2012-08-24 Sofradim Production FABRIC WITH PICOTS COATED WITH A BIORESORBABLE MICROPOROUS LAYER
FR2949687B1 (en) 2009-09-04 2011-09-23 Sofradim Production FABRIC WITH PICOTS COATED WITH WATER-SOLUBLE MATERIAL
AU2010337239B2 (en) 2009-12-14 2015-08-27 Ascension Orthopedics, Inc. Humeral head resurfacing implant
US8882740B2 (en) * 2009-12-23 2014-11-11 Stryker Trauma Gmbh Method of delivering a biphosphonate and/or strontium ranelate below the surface of a bone
JP5806289B2 (en) 2010-04-06 2015-11-10 ボストン サイエンティフィック サイムド,インコーポレイテッドBoston Scientific Scimed,Inc. Endoprosthesis
US20130180913A1 (en) * 2010-07-16 2013-07-18 Cnanoz Inc Water filtration system using hybrid nano carbon, silver, iron and aluminium oxide
WO2012051420A2 (en) * 2010-10-13 2012-04-19 Cibor, Inc. Synthetic bone grafts constructed from carbon foam materials
CN103313733A (en) 2010-11-15 2013-09-18 捷迈整形外科生物材料有限公司 Bone void fillers
CN102485184A (en) * 2010-12-03 2012-06-06 令狐恩强 Nanometer silver antibacterial biliary duct bracket and preparation method thereof
WO2012082989A2 (en) * 2010-12-17 2012-06-21 Bio2 Technologies, Inc. Method and apparatus for a porous orthopedic implant
WO2012094708A1 (en) * 2011-01-12 2012-07-19 The University Of Queensland Bone graft biomaterial
KR101240075B1 (en) * 2011-05-09 2013-03-07 동국대학교 산학협력단 Medical Implant and Method for Manufacturing the Same
FR2976577B1 (en) * 2011-06-17 2014-03-28 Saint Gobain METHOD FOR MANUFACTURING A GLAZING COMPRISING A POROUS LAYER
KR101277658B1 (en) * 2011-07-11 2013-06-21 조선대학교산학협력단 Method of preparing biomedical ceramic materials comprising multi-drug delivery system
RU2477627C1 (en) * 2011-07-18 2013-03-20 Общество с ограниченной ответственностью "ИЛЬКОМ" Polymer composite
CN104039312A (en) * 2011-08-16 2014-09-10 实验室护肤股份有限公司 Fine dry particulate adenosine compositions and topical formulations including same
US9484123B2 (en) 2011-09-16 2016-11-01 Prc-Desoto International, Inc. Conductive sealant compositions
KR101393592B1 (en) * 2012-03-06 2014-05-14 한양대학교 산학협력단 Artificial bone having excellent duration and manufacturing method for the same
RU2505602C1 (en) * 2012-06-04 2014-01-27 Федеральное государственное бюджетное учреждение "Российский кардиологический научно-производственный комплекс" Министерства здравоохранения и социального развития РФ (ФГБУ "РКНПК" Минздравсоцразвития России) Method for obtaining resident stem cells of mammal heart from myocard sample
EP2858554A4 (en) * 2012-06-11 2016-02-24 Univ California Method and system for in vivo hydrogen peroxide detection with ultrasound
DE102013201885A1 (en) 2013-02-05 2014-08-07 Urs Brodbeck Ceramic body, in particular for use in a bone implant, in particular as a dental implant
WO2014152228A1 (en) * 2013-03-14 2014-09-25 Osteoceramics, Inc. Systems and methods of using chemically bound antibiotics activated by infections
WO2014151580A1 (en) * 2013-03-15 2014-09-25 Clarion University of Pennsylvania Surface modified dental implant
KR101644686B1 (en) * 2014-04-17 2016-08-02 서울대학교산학협력단 Diverse implant for in vivo insertion coated with crosslinked polyphosphorylcholine
US11766506B2 (en) * 2016-03-04 2023-09-26 Mirus Llc Stent device for spinal fusion
RU2626896C1 (en) * 2016-11-11 2017-08-02 Общество с ограниченной ответственностью "ЭЛЕСТИМ-КАРДИО" Endocardial electrode system for left heart departments stimulation
KR102173645B1 (en) * 2018-12-28 2020-11-05 (주)에이치피케이 Drug releasing carbon fiber stent and manufacturing method for the same
CN109603769A (en) * 2019-01-08 2019-04-12 咸阳师范学院 A kind of preparation method and application of Adsorption of Phenol material
CN117064579B (en) * 2023-10-17 2024-01-12 山东百多安医疗器械股份有限公司 Silicon nitride ceramic implant and preparation method thereof

Family Cites Families (45)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3623164A (en) * 1969-10-06 1971-11-30 Gulf Oil Corp Prosthetic device
US3685059A (en) * 1970-07-28 1972-08-22 Gulf General Atomic Inc Prosthetic blood circulation device having a pyrolytic carbon coated blood contacting surface
US4209480A (en) * 1972-10-24 1980-06-24 Homsy Charles A Implantable material and method of preparing same
US4549977A (en) * 1976-09-29 1985-10-29 Colgate-Palmolive Company Bottled particulate detergent
JPS5441913A (en) * 1977-09-09 1979-04-03 Kanebo Ltd Carbonncarbon composite material and method of making same
US4318948A (en) * 1979-07-25 1982-03-09 Fordath Limited Article comprising carbon fibres and method of producing the article
JPS62119161A (en) * 1985-11-14 1987-05-30 呉羽化学工業株式会社 Flexible carbon material and manufacture
JP2852305B2 (en) * 1986-11-14 1999-02-03 杉郎 大谷 Artificial prosthesis materials
US5163958A (en) 1989-02-02 1992-11-17 Cordis Corporation Carbon coated tubular endoprosthesis
US4986943A (en) * 1989-02-28 1991-01-22 The Aerospace Corporation Method for oxidation stabilization of pitch-based matrices for carbon-carbon composites
US5171492A (en) * 1989-04-26 1992-12-15 Mitsubishi Pencil Co., Ltd. Process for producing carbonaceous implant material
US5209979A (en) * 1990-01-17 1993-05-11 Ethyl Corporation Silicon carbide coated article with ceramic topcoat
JPH04220261A (en) * 1990-12-19 1992-08-11 Sumitomo Electric Ind Ltd Diamond-coated member for living body
US5451444A (en) * 1993-01-29 1995-09-19 Deliso; Evelyn M. Carbon-coated inorganic substrates
US5382642A (en) * 1993-07-28 1995-01-17 Arco Chemical Technology, L.P. Copolymers of allyl alcohol propoxylates and vinyl aromatic monomers
US5516884A (en) * 1994-03-09 1996-05-14 The Penn State Research Foundation Preparation of polycarbynes and diamond-like carbon materials made therefrom
US5605714A (en) * 1994-03-29 1997-02-25 Southwest Research Institute Treatments to reduce thrombogeneticity in heart valves made from titanium and its alloys
DE69521709T2 (en) * 1994-09-23 2002-04-25 Impra Inc CARBON-BASED VESSEL TRANSPLANT AND MANUFACTURING METHOD
RU2095464C1 (en) 1996-01-12 1997-11-10 Акционерное общество закрытого типа "Тетра" Method and apparatus for preparing biocarbon
US5891507A (en) 1997-07-28 1999-04-06 Iowa-India Investments Company Limited Process for coating a surface of a metallic stent
US6156697A (en) * 1997-11-04 2000-12-05 Corning Incorporated Method of producing high surface area carbon structures
US6203505B1 (en) 1998-06-05 2001-03-20 Advanced Cardiovascular Systems, Inc. Guidewires having a vapor deposited primer coat
JP2002517285A (en) * 1998-06-09 2002-06-18 ハープスト フランツ Method for producing a biocompatible surface
EP1109738A4 (en) * 1998-07-20 2010-08-11 Corning Inc Method of making mesoporous carbon using pore formers
CA2351734A1 (en) * 1998-11-20 2000-06-02 University Of Connecticut Generic integrated implantable potentiostat telemetry unit for electrochemical sensors
JP2000237299A (en) * 1999-02-18 2000-09-05 Yasuhiro Fukui Biologically compatible material and method for forming it
US6372283B1 (en) * 1999-04-02 2002-04-16 Medtronic, Inc. Plasma process for surface modification of pyrolitic carbon
DE19951477A1 (en) 1999-10-26 2001-05-03 Biotronik Mess & Therapieg Stent
AU2001279759A1 (en) 2000-07-28 2002-02-13 Blue Medical Devices B.V. Intravascular stent with expandable coating
DE10051910A1 (en) * 2000-10-19 2002-05-02 Membrana Mundi Gmbh Flexible, porous membranes and adsorbents, and processes for their manufacture
US20040018228A1 (en) * 2000-11-06 2004-01-29 Afmedica, Inc. Compositions and methods for reducing scar tissue formation
US6544582B1 (en) * 2001-01-05 2003-04-08 Advanced Cardiovascular Systems, Inc. Method and apparatus for coating an implantable device
WO2002080996A1 (en) * 2001-04-03 2002-10-17 Franz Herbst Medical implant and method for producing the same
EP2319453B1 (en) * 2001-09-28 2016-07-20 Boston Scientific Limited A cardiovascular balloon catheter comprising nanocomposites
US20030093147A1 (en) * 2001-11-13 2003-05-15 Ogle Matthew F. Medical devices that stimulate growth factor production
US20030104028A1 (en) * 2001-11-29 2003-06-05 Hossainy Syed F.A. Rate limiting barriers for implantable devices and methods for fabrication thereof
CN1303132C (en) * 2002-03-25 2007-03-07 麻省大学 High molecular weight polymers
CZ295032B6 (en) 2002-05-23 2005-05-18 Škoda Auto a. s. Protective strip with illuminated effect for vehicle door sill
US6859986B2 (en) * 2003-02-20 2005-03-01 Cordis Corporation Method system for loading a self-expanding stent
DE202004009059U1 (en) 2003-05-16 2004-09-16 Blue Membranes Gmbh Substrates coated with carbon-based material
DE10324415A1 (en) 2003-05-28 2004-12-16 Blue Membranes Gmbh Coating procedure for coating substrates with carbon based material, comprises carbonation of polymer film in oxygen free environment at temperature ranging from 200 to 2500 degrees Celsius
DE10322182A1 (en) 2003-05-16 2004-12-02 Blue Membranes Gmbh Process for the production of porous, carbon-based material
WO2004101017A2 (en) 2003-05-16 2004-11-25 Blue Membranes Gmbh Medical implants comprising biocompatible coatings
DE10333098A1 (en) 2003-07-21 2005-02-10 Blue Membranes Gmbh New biocompatible, coated, implantable medicinal devices, e.g. stents, obtained by thermally carbonizing a polymeric coating, useful e.g. for controlled drug release
DE10335131A1 (en) 2003-07-31 2005-02-24 Blue Membranes Gmbh Porous carbon moldings, e.g. for catalyst support; insulant, tube membrane, ex or in vivo cell culture substrate or scaffold or implant, are made by molding carbonizable polymer and removing filler or partial oxidation to form pores

Also Published As

Publication number Publication date
AU2004243503A1 (en) 2004-12-09
PL1626749T3 (en) 2009-04-30
EP1626749A2 (en) 2006-02-22
MXPA05011231A (en) 2006-09-14
WO2004105826A2 (en) 2004-12-09
EP1626749B1 (en) 2008-10-08
JP2007502184A (en) 2007-02-08
EA200501561A1 (en) 2006-06-30
DK1626749T3 (en) 2009-02-09
KR20060015624A (en) 2006-02-17
ES2315661T3 (en) 2009-04-01
SI1626749T1 (en) 2009-04-30
ATE410196T1 (en) 2008-10-15
US20050079201A1 (en) 2005-04-14
DE202004009061U1 (en) 2004-08-12
HK1089702A1 (en) 2006-12-08
WO2004105826A3 (en) 2005-06-23
EP2033666A2 (en) 2009-03-11
DE502004008211D1 (en) 2008-11-20
BRPI0410957A (en) 2006-07-04
PT1626749E (en) 2009-01-14
EA009836B1 (en) 2008-04-28

Similar Documents

Publication Publication Date Title
US20050079201A1 (en) Implants with functionalized carbon surfaces
US20050079200A1 (en) Biocompatibly coated medical implants
CN100384490C (en) Medical implants comprising biocompatible coatings
EP1898969A2 (en) Medical devices comprising a reticulated composite material
AU2004285293B2 (en) Method for coating implants by way of a printing method
US20060171990A1 (en) Drug delivery materials made by sol/gel technology
CN100594040C (en) Implants comprising functional carbon coatings
DE10333098A1 (en) New biocompatible, coated, implantable medicinal devices, e.g. stents, obtained by thermally carbonizing a polymeric coating, useful e.g. for controlled drug release
DE10333099A1 (en) Medicinal implants, e.g. stents, with a functionalized surface, obtained by activating a carbon-containing coating to provide porosity then functionalizing, useful e.g. for controlled drug release
MXPA05011230A (en) Medical implants comprising biocompatible coatings

Legal Events

Date Code Title Description
EEER Examination request
FZDE Discontinued